Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 527439..528113 | Replicon | chromosome |
| Accession | NZ_CP102152 | ||
| Organism | Streptococcus suis strain DNS11 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A123U128 |
| Locus tag | NQZ88_RS02780 | Protein ID | WP_009910449.1 |
| Coordinates | 527931..528113 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A123TH46 |
| Locus tag | NQZ88_RS02775 | Protein ID | WP_023371005.1 |
| Coordinates | 527439..527891 (-) | Length | 151 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQZ88_RS02745 (NQZ88_02745) | 523576..524049 | + | 474 | WP_024378560.1 | IS200/IS605 family transposase | - |
| NQZ88_RS02750 (NQZ88_02750) | 524366..524530 | + | 165 | WP_024405641.1 | hypothetical protein | - |
| NQZ88_RS02755 (NQZ88_02755) | 524527..524844 | + | 318 | WP_024405642.1 | PadR family transcriptional regulator | - |
| NQZ88_RS02760 (NQZ88_02760) | 524846..525640 | + | 795 | WP_024405643.1 | hypothetical protein | - |
| NQZ88_RS02765 (NQZ88_02765) | 525642..526466 | + | 825 | WP_029750537.1 | hypothetical protein | - |
| NQZ88_RS02770 (NQZ88_02770) | 527118..527327 | - | 210 | WP_023371007.1 | hypothetical protein | - |
| NQZ88_RS02775 (NQZ88_02775) | 527439..527891 | - | 453 | WP_023371005.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NQZ88_RS02780 (NQZ88_02780) | 527931..528113 | - | 183 | WP_009910449.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NQZ88_RS02785 (NQZ88_02785) | 528297..528683 | - | 387 | WP_023371003.1 | hypothetical protein | - |
| NQZ88_RS02790 (NQZ88_02790) | 528824..529324 | - | 501 | WP_023371001.1 | hypothetical protein | - |
| NQZ88_RS02795 (NQZ88_02795) | 529394..529834 | - | 441 | WP_023370999.1 | hypothetical protein | - |
| NQZ88_RS02800 (NQZ88_02800) | 530180..531303 | - | 1124 | Protein_516 | phage/plasmid primase, P4 family | - |
| NQZ88_RS02805 (NQZ88_02805) | 531443..531916 | + | 474 | WP_024378560.1 | IS200/IS605 family transposase | - |
| NQZ88_RS02810 (NQZ88_02810) | 532010..532453 | - | 444 | WP_257116230.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 520638..549974 | 29336 | |
| - | flank | IS/Tn | - | - | 523576..524049 | 473 | |
| - | flank | IS/Tn | - | - | 531443..531916 | 473 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6681.93 Da Isoelectric Point: 10.8207
>T253256 WP_009910449.1 NZ_CP102152:c528113-527931 [Streptococcus suis]
MPMTQKEMVKLLTAHGWTKTKGGKGSHVKLEKVGERPITIPHGEINKYTERGIKKQAGLL
MPMTQKEMVKLLTAHGWTKTKGGKGSHVKLEKVGERPITIPHGEINKYTERGIKKQAGLL
Download Length: 183 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16685.68 Da Isoelectric Point: 4.0098
>AT253256 WP_023371005.1 NZ_CP102152:c527891-527439 [Streptococcus suis]
MLVTYPALFYYDDTDGANAPYFVTFPDFEHSATQGEDMADAMAMASDWLGIHLADYIENGRDIPTPTPINALSLADNNPF
RDDKDIELVYDPSKSFVSMVMVDVAEYLGSQEPVKKTLTIPRWADTLGRELGLNFSQTLTDAIADKKIHA
MLVTYPALFYYDDTDGANAPYFVTFPDFEHSATQGEDMADAMAMASDWLGIHLADYIENGRDIPTPTPINALSLADNNPF
RDDKDIELVYDPSKSFVSMVMVDVAEYLGSQEPVKKTLTIPRWADTLGRELGLNFSQTLTDAIADKKIHA
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A123U128 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A123TH46 |