Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 2241089..2241564 Replicon chromosome
Accession NZ_CP102149
Organism Streptococcus suis strain DNC13

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag NQZ89_RS11540 Protein ID WP_172067485.1
Coordinates 2241301..2241564 (+) Length 88 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag NQZ89_RS11535 Protein ID WP_172067487.1
Coordinates 2241089..2241304 (+) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NQZ89_RS11505 (NQZ89_11505) 2236632..2236874 + 243 WP_172095038.1 hypothetical protein -
NQZ89_RS11510 (NQZ89_11510) 2237097..2237615 + 519 WP_105123271.1 ribosome maturation factor RimM -
NQZ89_RS11515 (NQZ89_11515) 2237605..2238333 + 729 WP_105123272.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
NQZ89_RS11520 (NQZ89_11520) 2238561..2239583 + 1023 WP_257104464.1 branched-chain amino acid aminotransferase -
NQZ89_RS11525 (NQZ89_11525) 2239770..2240719 + 950 Protein_2232 IS30 family transposase -
NQZ89_RS11530 (NQZ89_11530) 2240759..2240896 + 138 WP_257104465.1 hypothetical protein -
NQZ89_RS11535 (NQZ89_11535) 2241089..2241304 + 216 WP_172067487.1 DUF6290 family protein Antitoxin
NQZ89_RS11540 (NQZ89_11540) 2241301..2241564 + 264 WP_172067485.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NQZ89_RS11545 (NQZ89_11545) 2241632..2242693 + 1062 WP_172074744.1 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme -
NQZ89_RS11550 (NQZ89_11550) 2242803..2243546 + 744 WP_257104466.1 DeoR/GlpR family DNA-binding transcription regulator -
NQZ89_RS11555 (NQZ89_11555) 2243543..2244454 + 912 WP_257104467.1 1-phosphofructokinase -
NQZ89_RS11560 (NQZ89_11560) 2244451..2246406 + 1956 WP_257104468.1 fructose-specific PTS transporter subunit EIIC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 2240081..2240608 527


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-87)

Antitoxin

Protein of unknown function DUF6290

(1-69)


Sequences

Toxin        


Download         Length: 88 a.a.        Molecular weight: 10300.83 Da        Isoelectric Point: 10.7218

>T253255 WP_172067485.1 NZ_CP102149:2241301-2241564 [Streptococcus suis]
MSYKVRLTPKANKQLRKLDAYTRNTILTWIKKNLYQTDNPRLHGKGLTANRSGAWRYRVGNYRILANIYDDEIVIEVFAI
GHRRDSY

Download         Length: 264 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 8276.41 Da        Isoelectric Point: 4.0414

>AT253255 WP_172067487.1 NZ_CP102149:2241089-2241304 [Streptococcus suis]
MTTMTLRINDEDSKLIKNYIQLHGLTISEFARQAMLERIEDEYDLAVLRQAMAEDDGVRIPIEDLFEEFGI

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References