Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 1892493..1893108 | Replicon | chromosome |
Accession | NZ_CP102148 | ||
Organism | Streptococcus suis strain DNC15 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | NQZ90_RS09210 | Protein ID | WP_161496224.1 |
Coordinates | 1892493..1892828 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A075SJ65 |
Locus tag | NQZ90_RS09215 | Protein ID | WP_024381089.1 |
Coordinates | 1892821..1893108 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQZ90_RS09190 (NQZ90_09190) | 1888384..1888569 | - | 186 | WP_009910840.1 | hypothetical protein | - |
NQZ90_RS09195 (NQZ90_09195) | 1888563..1889336 | - | 774 | WP_105141534.1 | nucleoside phosphorylase | - |
NQZ90_RS09200 (NQZ90_09200) | 1889351..1889968 | - | 618 | WP_105141533.1 | serine O-acetyltransferase | - |
NQZ90_RS09205 (NQZ90_09205) | 1890022..1892241 | - | 2220 | WP_105141532.1 | polyribonucleotide nucleotidyltransferase | - |
NQZ90_RS09210 (NQZ90_09210) | 1892493..1892828 | - | 336 | WP_161496224.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NQZ90_RS09215 (NQZ90_09215) | 1892821..1893108 | - | 288 | WP_024381089.1 | XRE family transcriptional regulator | Antitoxin |
NQZ90_RS09220 (NQZ90_09220) | 1893515..1893784 | - | 270 | WP_002938849.1 | 30S ribosomal protein S15 | - |
NQZ90_RS09225 (NQZ90_09225) | 1893987..1895264 | - | 1278 | WP_024407945.1 | solute carrier family 23 protein | - |
NQZ90_RS09230 (NQZ90_09230) | 1895518..1897413 | - | 1896 | WP_044673271.1 | DUF262 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12783.86 Da Isoelectric Point: 9.5189
>T253248 WP_161496224.1 NZ_CP102148:c1892828-1892493 [Streptococcus suis]
MDKYQVNLPLAIYEELAAIRSYIREELKSPDAADKKIQELIAGLRSLEIFPERGFNVDERSKKGPLVPGHLTRGLPIKKD
YIAIYNIDEAQKVVNVRYLVASKSDYMRLFK
MDKYQVNLPLAIYEELAAIRSYIREELKSPDAADKKIQELIAGLRSLEIFPERGFNVDERSKKGPLVPGHLTRGLPIKKD
YIAIYNIDEAQKVVNVRYLVASKSDYMRLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|