253237

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1510355..1511029 Replicon chromosome
Accession NZ_CP102143
Organism Streptococcus suis strain DNR43

Toxin (Protein)


Gene name hicA Uniprot ID A0A123U128
Locus tag NQZ92_RS07690 Protein ID WP_009910449.1
Coordinates 1510847..1511029 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A7Y6VEQ2
Locus tag NQZ92_RS07685 Protein ID WP_009910448.1
Coordinates 1510355..1510807 (-) Length 151 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NQZ92_RS07655 (NQZ92_07655) 1506350..1507354 + 1005 WP_009910438.1 lactonase family protein -
NQZ92_RS07660 (NQZ92_07660) 1507418..1507603 + 186 WP_002935693.1 hypothetical protein -
NQZ92_RS07665 (NQZ92_07665) 1507636..1508277 - 642 WP_002935700.1 HAD family hydrolase -
NQZ92_RS07670 (NQZ92_07670) 1508444..1508704 - 261 WP_009910443.1 type II toxin-antitoxin system RelE/ParE family toxin -
NQZ92_RS07675 (NQZ92_07675) 1508706..1508927 - 222 WP_012775256.1 DUF6290 family protein -
NQZ92_RS07680 (NQZ92_07680) 1510034..1510243 - 210 WP_009910447.1 hypothetical protein -
NQZ92_RS07685 (NQZ92_07685) 1510355..1510807 - 453 WP_009910448.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NQZ92_RS07690 (NQZ92_07690) 1510847..1511029 - 183 WP_009910449.1 type II toxin-antitoxin system HicA family toxin Toxin
NQZ92_RS07695 (NQZ92_07695) 1511213..1511599 - 387 WP_009910450.1 hypothetical protein -
NQZ92_RS07700 (NQZ92_07700) 1511739..1512239 - 501 WP_024409209.1 hypothetical protein -
NQZ92_RS07705 (NQZ92_07705) 1512309..1512749 - 441 WP_024409208.1 hypothetical protein -
NQZ92_RS07710 (NQZ92_07710) 1513217..1514062 - 846 WP_024409207.1 ATP-binding protein -
NQZ92_RS07715 (NQZ92_07715) 1514078..1514908 - 831 WP_024409206.1 DnaD domain protein -
NQZ92_RS07720 (NQZ92_07720) 1514886..1515101 - 216 WP_024409205.1 hypothetical protein -
NQZ92_RS07725 (NQZ92_07725) 1515106..1515264 - 159 WP_162841287.1 hypothetical protein -
NQZ92_RS07730 (NQZ92_07730) 1515275..1515541 - 267 WP_024409204.1 hypothetical protein -
NQZ92_RS07735 (NQZ92_07735) 1515552..1515755 - 204 WP_024409203.1 hypothetical protein -
NQZ92_RS07740 (NQZ92_07740) 1515748..1515951 - 204 WP_024409202.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1507418..1518533 11115


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(6-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(17-82)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6681.93 Da        Isoelectric Point: 10.8207

>T253237 WP_009910449.1 NZ_CP102143:c1511029-1510847 [Streptococcus suis]
MPMTQKEMVKLLTAHGWTKTKGGKGSHVKLEKVGERPITIPHGEINKYTERGIKKQAGLL

Download         Length: 183 bp

Antitoxin


Download         Length: 151 a.a.        Molecular weight: 16672.68 Da        Isoelectric Point: 4.0098

>AT253237 WP_009910448.1 NZ_CP102143:c1510807-1510355 [Streptococcus suis]
MLVTYPALFYYDDTDGATAPYFVTFPDFEHSATQGEDMADAMAMASDWLGIHLADYIENGRDIPTPTPINALSLADNNPF
RDDKDIELVYDPSKSFVSMVMVDVAEYLGSQEPVKKTLTIPRWADTLGRELGLNFSQTLTDAIADKKIHA

Download         Length: 453 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A123U128

Antitoxin

Source ID Structure
AlphaFold DB A0A7Y6VEQ2

References