Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelB(antitoxin)
Location 2115507..2116113 Replicon chromosome
Accession NZ_CP102141
Organism Streptococcus suis strain DNR48

Toxin (Protein)


Gene name parE Uniprot ID A0A075SGI8
Locus tag NQZ93_RS10550 Protein ID WP_024381176.1
Coordinates 2115507..2115836 (-) Length 110 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A075SKR5
Locus tag NQZ93_RS10555 Protein ID WP_024381177.1
Coordinates 2115826..2116113 (-) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NQZ93_RS10505 (NQZ93_10505) 2110524..2111012 - 489 WP_024388325.1 hypothetical protein -
NQZ93_RS10510 (NQZ93_10510) 2111090..2111674 - 585 WP_024388324.1 CPBP family intramembrane metalloprotease -
NQZ93_RS10515 (NQZ93_10515) 2111677..2111910 - 234 WP_014636955.1 hypothetical protein -
NQZ93_RS10520 (NQZ93_10520) 2111919..2112302 - 384 WP_024388323.1 arsenate reductase -
NQZ93_RS10525 (NQZ93_10525) 2112313..2112741 - 429 WP_024388322.1 hypothetical protein -
NQZ93_RS10530 (NQZ93_10530) 2112725..2114080 - 1356 WP_029694639.1 DNA (cytosine-5-)-methyltransferase -
NQZ93_RS10535 (NQZ93_10535) 2114229..2115047 - 819 WP_024388321.1 replication initiator protein A -
NQZ93_RS10540 (NQZ93_10540) 2115044..2115217 - 174 WP_032514560.1 hypothetical protein -
NQZ93_RS10545 (NQZ93_10545) 2115384..2115500 - 117 Protein_2040 DNA mismatch repair protein MutT -
NQZ93_RS10550 (NQZ93_10550) 2115507..2115836 - 330 WP_024381176.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NQZ93_RS10555 (NQZ93_10555) 2115826..2116113 - 288 WP_024381177.1 hypothetical protein Antitoxin
NQZ93_RS10560 (NQZ93_10560) 2116211..2116579 - 369 WP_024381178.1 hypothetical protein -
NQZ93_RS10565 (NQZ93_10565) 2116572..2117138 - 567 WP_024381179.1 ribonuclease M5 -
NQZ93_RS10570 (NQZ93_10570) 2117122..2117904 - 783 WP_024381180.1 TatD family hydrolase -
NQZ93_RS10575 (NQZ93_10575) 2118011..2118148 - 138 WP_002939016.1 50S ribosomal protein L34 -
NQZ93_RS10580 (NQZ93_10580) 2118316..2119311 - 996 WP_024381181.1 RNA-binding cell elongation regulator Jag/EloR -
NQZ93_RS10585 (NQZ93_10585) 2119331..2120143 - 813 WP_024381182.1 membrane protein insertase YidC -
NQZ93_RS10590 (NQZ93_10590) 2120127..2120486 - 360 WP_004194560.1 ribonuclease P protein component -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-95)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 110 a.a.        Molecular weight: 12575.52 Da        Isoelectric Point: 8.3572

>T253232 WP_024381176.1 NZ_CP102141:c2115836-2115507 [Streptococcus suis]
MEFESYSVILAPAVERELAAIYAYFSEQFSEEIAKRRIGMIVQALESLQIFPERGFNADNRFGKQIDPPHLTRGYVIGKD
YIALYRVVKNEVRVGHLFATKSDYVKLLK

Download         Length: 330 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10897.49 Da        Isoelectric Point: 4.3472

>AT253232 WP_024381177.1 NZ_CP102141:c2116113-2115826 [Streptococcus suis]
MITIKKDAQVNFKTDSRLLEKAKEVFAMNQLDLTAGFNLFLQNIAVKNELPILTEEELEREELFLQLQKEIQENQQAIEA
GQGISLESVKEKYGI

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A075SGI8

Antitoxin

Source ID Structure
AlphaFold DB A0A075SKR5

References