Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 1929209..1929824 | Replicon | chromosome |
Accession | NZ_CP102141 | ||
Organism | Streptococcus suis strain DNR48 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | NQZ93_RS09560 | Protein ID | WP_024389183.1 |
Coordinates | 1929209..1929544 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A075SJ65 |
Locus tag | NQZ93_RS09565 | Protein ID | WP_024381089.1 |
Coordinates | 1929537..1929824 (-) | Length | 96 a.a. |
Genomic Context
Location: 1925100..1925285 (186 bp)
Type: Others
Protein ID: WP_009910840.1
Type: Others
Protein ID: WP_009910840.1
Location: 1925279..1926052 (774 bp)
Type: Others
Protein ID: WP_024381086.1
Type: Others
Protein ID: WP_024381086.1
Location: 1926067..1926684 (618 bp)
Type: Others
Protein ID: WP_015647409.1
Type: Others
Protein ID: WP_015647409.1
Location: 1926738..1928957 (2220 bp)
Type: Others
Protein ID: WP_024381087.1
Type: Others
Protein ID: WP_024381087.1
Location: 1929209..1929544 (336 bp)
Type: Toxin
Protein ID: WP_024389183.1
Type: Toxin
Protein ID: WP_024389183.1
Location: 1929537..1929824 (288 bp)
Type: Antitoxin
Protein ID: WP_024381089.1
Type: Antitoxin
Protein ID: WP_024381089.1
Location: 1930138..1930407 (270 bp)
Type: Others
Protein ID: WP_002938849.1
Type: Others
Protein ID: WP_002938849.1
Location: 1930662..1931303 (642 bp)
Type: Others
Protein ID: WP_002938850.1
Type: Others
Protein ID: WP_002938850.1
Location: 1931296..1932042 (747 bp)
Type: Others
Protein ID: WP_225533344.1
Type: Others
Protein ID: WP_225533344.1
Location: 1932791..1933555 (765 bp)
Type: Others
Protein ID: WP_002938853.1
Type: Others
Protein ID: WP_002938853.1
Location: 1933640..1934050 (411 bp)
Type: Others
Protein ID: WP_013730575.1
Type: Others
Protein ID: WP_013730575.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQZ93_RS09540 (NQZ93_09540) | 1925100..1925285 | - | 186 | WP_009910840.1 | hypothetical protein | - |
NQZ93_RS09545 (NQZ93_09545) | 1925279..1926052 | - | 774 | WP_024381086.1 | nucleoside phosphorylase | - |
NQZ93_RS09550 (NQZ93_09550) | 1926067..1926684 | - | 618 | WP_015647409.1 | serine O-acetyltransferase | - |
NQZ93_RS09555 (NQZ93_09555) | 1926738..1928957 | - | 2220 | WP_024381087.1 | polyribonucleotide nucleotidyltransferase | - |
NQZ93_RS09560 (NQZ93_09560) | 1929209..1929544 | - | 336 | WP_024389183.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NQZ93_RS09565 (NQZ93_09565) | 1929537..1929824 | - | 288 | WP_024381089.1 | XRE family transcriptional regulator | Antitoxin |
NQZ93_RS09570 (NQZ93_09570) | 1930138..1930407 | - | 270 | WP_002938849.1 | 30S ribosomal protein S15 | - |
NQZ93_RS09575 (NQZ93_09575) | 1930662..1931303 | - | 642 | WP_002938850.1 | ABC transporter ATP-binding protein | - |
NQZ93_RS09580 (NQZ93_09580) | 1931296..1932042 | - | 747 | WP_225533344.1 | hypothetical protein | - |
NQZ93_RS09585 (NQZ93_09585) | 1932791..1933555 | - | 765 | WP_002938853.1 | hypothetical protein | - |
NQZ93_RS09590 (NQZ93_09590) | 1933640..1934050 | - | 411 | WP_013730575.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12818.86 Da Isoelectric Point: 9.1835
>T253228 WP_024389183.1 NZ_CP102141:c1929544-1929209 [Streptococcus suis]
MDKYQVNLPLAIYEELADIRSYIREELKSPDAADKKIQELIAGLRSLEIFPERGFNVDERSKKGPLVPGQLTRGLPIKKD
YIAIYNIDEAQKVVNVRYLVASKSDYMRLFK
MDKYQVNLPLAIYEELADIRSYIREELKSPDAADKKIQELIAGLRSLEIFPERGFNVDERSKKGPLVPGQLTRGLPIKKD
YIAIYNIDEAQKVVNVRYLVASKSDYMRLFK
Download Length: 336 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A075SJ65 |