Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1420439..1421113 Replicon chromosome
Accession NZ_CP102140
Organism Streptococcus suis strain DNC49

Toxin (Protein)


Gene name hicA Uniprot ID A0A123U128
Locus tag NQZ94_RS07170 Protein ID WP_009910449.1
Coordinates 1420931..1421113 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A7Y6VEQ2
Locus tag NQZ94_RS07165 Protein ID WP_009910448.1
Coordinates 1420439..1420891 (-) Length 151 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NQZ94_RS07135 (NQZ94_07135) 1416434..1417438 + 1005 WP_009910438.1 lactonase family protein -
NQZ94_RS07140 (NQZ94_07140) 1417502..1417687 + 186 WP_002935693.1 hypothetical protein -
NQZ94_RS07145 (NQZ94_07145) 1417720..1418361 - 642 WP_002935700.1 HAD family hydrolase -
NQZ94_RS07150 (NQZ94_07150) 1418528..1418788 - 261 WP_009910443.1 type II toxin-antitoxin system RelE/ParE family toxin -
NQZ94_RS07155 (NQZ94_07155) 1418790..1419011 - 222 WP_012775256.1 DUF6290 family protein -
NQZ94_RS07160 (NQZ94_07160) 1420118..1420327 - 210 WP_009910447.1 hypothetical protein -
NQZ94_RS07165 (NQZ94_07165) 1420439..1420891 - 453 WP_009910448.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NQZ94_RS07170 (NQZ94_07170) 1420931..1421113 - 183 WP_009910449.1 type II toxin-antitoxin system HicA family toxin Toxin
NQZ94_RS07175 (NQZ94_07175) 1421297..1421683 - 387 WP_009910450.1 hypothetical protein -
NQZ94_RS07180 (NQZ94_07180) 1421823..1422323 - 501 WP_024409209.1 hypothetical protein -
NQZ94_RS07185 (NQZ94_07185) 1422393..1422833 - 441 WP_024409208.1 hypothetical protein -
NQZ94_RS07190 (NQZ94_07190) 1423301..1424146 - 846 WP_024409207.1 ATP-binding protein -
NQZ94_RS07195 (NQZ94_07195) 1424162..1424992 - 831 WP_024409206.1 DnaD domain protein -
NQZ94_RS07200 (NQZ94_07200) 1424970..1425185 - 216 WP_024409205.1 hypothetical protein -
NQZ94_RS07205 (NQZ94_07205) 1425190..1425348 - 159 WP_162841287.1 hypothetical protein -
NQZ94_RS07210 (NQZ94_07210) 1425359..1425625 - 267 WP_024409204.1 hypothetical protein -
NQZ94_RS07215 (NQZ94_07215) 1425636..1425839 - 204 WP_024409203.1 hypothetical protein -
NQZ94_RS07220 (NQZ94_07220) 1425832..1426035 - 204 WP_024409202.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1417502..1428617 11115


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(6-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(17-82)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6681.93 Da        Isoelectric Point: 10.8207

>T253224 WP_009910449.1 NZ_CP102140:c1421113-1420931 [Streptococcus suis]
MPMTQKEMVKLLTAHGWTKTKGGKGSHVKLEKVGERPITIPHGEINKYTERGIKKQAGLL

Download         Length: 183 bp

Antitoxin


Download         Length: 151 a.a.        Molecular weight: 16672.68 Da        Isoelectric Point: 4.0098

>AT253224 WP_009910448.1 NZ_CP102140:c1420891-1420439 [Streptococcus suis]
MLVTYPALFYYDDTDGATAPYFVTFPDFEHSATQGEDMADAMAMASDWLGIHLADYIENGRDIPTPTPINALSLADNNPF
RDDKDIELVYDPSKSFVSMVMVDVAEYLGSQEPVKKTLTIPRWADTLGRELGLNFSQTLTDAIADKKIHA

Download         Length: 453 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A123U128

Antitoxin

Source ID Structure
AlphaFold DB A0A7Y6VEQ2

References