Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 1418528..1419011 Replicon chromosome
Accession NZ_CP102140
Organism Streptococcus suis strain DNC49

Toxin (Protein)


Gene name relE Uniprot ID A0A0Z8BIZ7
Locus tag NQZ94_RS07150 Protein ID WP_009910443.1
Coordinates 1418528..1418788 (-) Length 87 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A0Z8BIX7
Locus tag NQZ94_RS07155 Protein ID WP_012775256.1
Coordinates 1418790..1419011 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NQZ94_RS07125 (NQZ94_07125) 1413913..1415142 - 1230 WP_009910437.1 tetratricopeptide repeat protein -
NQZ94_RS07130 (NQZ94_07130) 1415132..1416298 - 1167 WP_002935690.1 AI-2E family transporter -
NQZ94_RS07135 (NQZ94_07135) 1416434..1417438 + 1005 WP_009910438.1 lactonase family protein -
NQZ94_RS07140 (NQZ94_07140) 1417502..1417687 + 186 WP_002935693.1 hypothetical protein -
NQZ94_RS07145 (NQZ94_07145) 1417720..1418361 - 642 WP_002935700.1 HAD family hydrolase -
NQZ94_RS07150 (NQZ94_07150) 1418528..1418788 - 261 WP_009910443.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NQZ94_RS07155 (NQZ94_07155) 1418790..1419011 - 222 WP_012775256.1 DUF6290 family protein Antitoxin
NQZ94_RS07160 (NQZ94_07160) 1420118..1420327 - 210 WP_009910447.1 hypothetical protein -
NQZ94_RS07165 (NQZ94_07165) 1420439..1420891 - 453 WP_009910448.1 type II toxin-antitoxin system HicB family antitoxin -
NQZ94_RS07170 (NQZ94_07170) 1420931..1421113 - 183 WP_009910449.1 type II toxin-antitoxin system HicA family toxin -
NQZ94_RS07175 (NQZ94_07175) 1421297..1421683 - 387 WP_009910450.1 hypothetical protein -
NQZ94_RS07180 (NQZ94_07180) 1421823..1422323 - 501 WP_024409209.1 hypothetical protein -
NQZ94_RS07185 (NQZ94_07185) 1422393..1422833 - 441 WP_024409208.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1417502..1428617 11115


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-86)

Antitoxin

Protein of unknown function DUF6290

(1-71)


Sequences

Toxin        


Download         Length: 87 a.a.        Molecular weight: 10270.78 Da        Isoelectric Point: 9.6925

>T253223 WP_009910443.1 NZ_CP102140:c1418788-1418528 [Streptococcus suis]
MYHLEYSKKAQKQIKKLDRQIQRLLFAWIDKHLEGTDNPRANGKGLTGNHANEWRYRIGDYRLICDIQDDKLVILALEFG
HRKDVY

Download         Length: 261 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8566.55 Da        Isoelectric Point: 4.4791

>AT253223 WP_012775256.1 NZ_CP102140:c1419011-1418790 [Streptococcus suis]
MSTVTIRLNQEEEVFFKSYAQLTGQSLSSLFKKALERDIEDEYDLKIYHQAYDEYKADPETISHADFKKELGL

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0Z8BIZ7

Antitoxin

Source ID Structure
AlphaFold DB A0A0Z8BIX7

References