Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 1007647..1008133 Replicon chromosome
Accession NZ_CP102140
Organism Streptococcus suis strain DNC49

Toxin (Protein)


Gene name relE Uniprot ID A0A0K2E5U8
Locus tag NQZ94_RS05135 Protein ID WP_002935012.1
Coordinates 1007647..1007904 (-) Length 86 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A0K2E5B0
Locus tag NQZ94_RS05140 Protein ID WP_002935014.1
Coordinates 1007894..1008133 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NQZ94_RS05115 (NQZ94_05115) 1003281..1004351 + 1071 WP_002935006.1 tyrosine recombinase XerS -
NQZ94_RS05120 (NQZ94_05120) 1004421..1005929 - 1509 WP_013730362.1 phosphoglucomutase -
NQZ94_RS05125 (NQZ94_05125) 1006005..1006946 - 942 WP_002935009.1 sensor histidine kinase -
NQZ94_RS05130 (NQZ94_05130) 1006943..1007608 - 666 WP_009909826.1 response regulator transcription factor -
NQZ94_RS05135 (NQZ94_05135) 1007647..1007904 - 258 WP_002935012.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NQZ94_RS05140 (NQZ94_05140) 1007894..1008133 - 240 WP_002935014.1 DUF6290 family protein Antitoxin
NQZ94_RS05145 (NQZ94_05145) 1008225..1010195 - 1971 WP_257116277.1 FtsX-like permease family protein -
NQZ94_RS05150 (NQZ94_05150) 1010196..1010948 - 753 WP_002935019.1 ABC transporter ATP-binding protein -
NQZ94_RS05155 (NQZ94_05155) 1010965..1011348 - 384 WP_002935021.1 NisI/SpaI family lantibiotic immunity lipoprotein -
NQZ94_RS05160 (NQZ94_05160) 1011361..1011501 - 141 WP_002935023.1 hypothetical protein -
NQZ94_RS05165 (NQZ94_05165) 1011600..1012334 - 735 WP_002935025.1 TraX family protein -
NQZ94_RS05170 (NQZ94_05170) 1012347..1012484 - 138 WP_002935027.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-75)

Antitoxin

Protein of unknown function DUF6290

(1-74)


Sequences

Toxin        


Download         Length: 86 a.a.        Molecular weight: 9849.52 Da        Isoelectric Point: 10.7134

>T253221 WP_002935012.1 NZ_CP102140:c1007904-1007647 [Streptococcus suis]
MSYKVILSAKAQKQIRKMDKTAASLILRYLYKHIDGCDNPRQYGKALTANRSGQWRYRIGNYRVIVNIEDDKLIVTSIKM
RNGSI

Download         Length: 258 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8924.19 Da        Isoelectric Point: 3.9191

>AT253221 WP_002935014.1 NZ_CP102140:c1008133-1007894 [Streptococcus suis]
MAAITLKVSEQDKLFMQAMAKFEGVSLSELIRTKTLEALEDEYDARVADVAWAEYQADLANRIEPMTLEQMAEELGIEL

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0K2E5U8

Antitoxin

Source ID Structure
AlphaFold DB A0A0K2E5B0

References