Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) omega-epsilon-zeta/zeta-epsilon
Location 1040195..1040738 Replicon chromosome
Accession NZ_CP102138
Organism Streptococcus suis strain M102942_S11

Toxin (Protein)


Gene name zeta Uniprot ID A0A1X9I2P4
Locus tag NQZ95_RS05245 Protein ID WP_002943355.1
Coordinates 1040195..1040464 (-) Length 90 a.a.

Antitoxin (Protein)


Gene name epsilon Uniprot ID Q9AL19
Locus tag NQZ95_RS05250 Protein ID WP_002326825.1
Coordinates 1040466..1040738 (-) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NQZ95_RS05200 (NQZ95_05200) 1035282..1035578 - 297 WP_257105118.1 hypothetical protein -
NQZ95_RS05205 (NQZ95_05205) 1035633..1036022 - 390 WP_248041236.1 DUF5945 family protein -
NQZ95_RS05210 (NQZ95_05210) 1036019..1036246 - 228 WP_024380481.1 DUF5965 family protein -
NQZ95_RS05215 (NQZ95_05215) 1036300..1037376 - 1077 WP_070008348.1 toprim domain-containing protein -
NQZ95_RS05220 (NQZ95_05220) 1037416..1038054 - 639 WP_024408866.1 hypothetical protein -
NQZ95_RS05225 (NQZ95_05225) 1038150..1038440 - 291 WP_024408865.1 DUF5966 family protein -
NQZ95_RS05230 (NQZ95_05230) 1038454..1038753 - 300 WP_024408864.1 DUF5962 family protein -
NQZ95_RS05235 (NQZ95_05235) 1038824..1039783 - 960 Protein_999 hypothetical protein -
NQZ95_RS05240 (NQZ95_05240) 1039776..1040097 - 322 Protein_1000 DUF4368 domain-containing protein -
NQZ95_RS05245 (NQZ95_05245) 1040195..1040464 - 270 WP_002943355.1 zeta toxin family protein Toxin
NQZ95_RS05250 (NQZ95_05250) 1040466..1040738 - 273 WP_002326825.1 antitoxin Antitoxin
NQZ95_RS05255 (NQZ95_05255) 1040756..1040971 - 216 WP_001835296.1 peptide-binding protein -
NQZ95_RS05260 (NQZ95_05260) 1041063..1041959 - 897 WP_002326827.1 ParA family protein -
NQZ95_RS05265 (NQZ95_05265) 1042041..1042301 - 261 Protein_1005 topoisomerase DNA-binding C4 zinc finger domain-containing protein -
NQZ95_RS05270 (NQZ95_05270) 1042471..1043208 - 738 WP_001038795.1 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) -
NQZ95_RS05275 (NQZ95_05275) 1043363..1043416 - 54 WP_117115223.1 23S rRNA methyltransferase attenuation leader peptide -
NQZ95_RS05280 (NQZ95_05280) 1043465..1043704 - 240 WP_000635249.1 peptide-binding protein -
NQZ95_RS05285 (NQZ95_05285) 1043796..1044896 - 1101 Protein_1009 recombinase family protein -
NQZ95_RS05290 (NQZ95_05290) 1044950..1045141 - 192 WP_000503424.1 hypothetical protein -
NQZ95_RS05295 (NQZ95_05295) 1045212..1045442 - 231 WP_000659121.1 PC4/YdbC family ssDNA-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element erm(B) / tet(O) - 1018887..1125720 106833


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Zeta toxin domain

(27-75)

Antitoxin

Bacterial epsilon antitoxin

(2-90)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 9999.08 Da        Isoelectric Point: 8.7696

>T253217 WP_002943355.1 NZ_CP102138:c1040464-1040195 [Streptococcus suis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPRSTFAN
VNKRNNFNS

Download         Length: 270 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 10720.17 Da        Isoelectric Point: 4.4865

>AT253217 WP_002326825.1 NZ_CP102138:c1040738-1040466 [Streptococcus suis]
MAVTYEKTFEIEIINELSASVYNRVLNYVLNHELDTKNTRLLEVNLLNQLEVAQEVDLFQQPFEELQAIHEYWRSMNQYS
KQILTKEKVA

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1X9I2P4

Antitoxin

Source ID Structure
AlphaFold DB A0A0M2AF93

References