Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 663866..664352 Replicon chromosome
Accession NZ_CP102137
Organism Streptococcus suis strain M104300_S20

Toxin (Protein)


Gene name relE Uniprot ID D5AGV2
Locus tag NQZ96_RS03290 Protein ID WP_011922754.1
Coordinates 664083..664352 (+) Length 90 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID D5AGV1
Locus tag NQZ96_RS03285 Protein ID WP_002938604.1
Coordinates 663866..664093 (+) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NQZ96_RS03260 (NQZ96_03260) 658909..659358 - 450 WP_009909619.1 MarR family transcriptional regulator -
NQZ96_RS03265 (NQZ96_03265) 659652..660499 + 848 WP_087892711.1 IS630 family transposase -
NQZ96_RS03270 (NQZ96_03270) 660558..661055 + 498 WP_011922751.1 DUF5590 domain-containing protein -
NQZ96_RS03275 (NQZ96_03275) 661052..662233 + 1182 WP_011922154.1 pyridoxal phosphate-dependent aminotransferase -
NQZ96_RS03280 (NQZ96_03280) 662248..663594 + 1347 WP_011922752.1 asparagine--tRNA ligase -
NQZ96_RS03285 (NQZ96_03285) 663866..664093 + 228 WP_002938604.1 DUF6290 family protein Antitoxin
NQZ96_RS03290 (NQZ96_03290) 664083..664352 + 270 WP_011922754.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NQZ96_RS03295 (NQZ96_03295) 664758..666077 + 1320 WP_012775027.1 MATE family efflux transporter -
NQZ96_RS03300 (NQZ96_03300) 666128..666505 + 378 WP_002937263.1 RidA family protein -
NQZ96_RS03305 (NQZ96_03305) 666527..667414 + 888 WP_011922160.1 RNase adapter RapZ -
NQZ96_RS03310 (NQZ96_03310) 667411..668385 + 975 WP_002937257.1 YvcK family protein -
NQZ96_RS03315 (NQZ96_03315) 668382..669299 + 918 WP_002937252.1 DNA-binding protein WhiA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-87)

Antitoxin

Protein of unknown function DUF6290

(1-71)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10437.49 Da        Isoelectric Point: 10.3916

>T253211 WP_011922754.1 NZ_CP102137:664083-664352 [Streptococcus suis]
MAYKLVLSDDALKQLKKMDRHVGMMLAKDLKKRLDGLENPRQFGKALVGDYKGLWRYRVGNYRVICDIIDNKMVILALEI
GHRKEIYKK

Download         Length: 270 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8450.51 Da        Isoelectric Point: 4.1589

>AT253211 WP_002938604.1 NZ_CP102137:663866-664093 [Streptococcus suis]
MGIVSLRLNDAEEEIFRSYAIHTGKSLSELFKTALAEQIEDQLDYEIGIKALKKFQENPVTHSIDDVLAELEDGL

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A126UKS2

Antitoxin

Source ID Structure
AlphaFold DB A0A140EXF0

References