Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 2220408..2221014 | Replicon | chromosome |
| Accession | NZ_CP102136 | ||
| Organism | Streptococcus suis strain M105052_S26 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | NQZ97_RS10785 | Protein ID | WP_105130673.1 |
| Coordinates | 2220408..2220737 (-) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A075SKR5 |
| Locus tag | NQZ97_RS10790 | Protein ID | WP_024381177.1 |
| Coordinates | 2220727..2221014 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQZ97_RS10750 (NQZ97_10750) | 2217378..2217735 | - | 358 | Protein_2080 | IS200/IS605 family transposase | - |
| NQZ97_RS10755 (NQZ97_10755) | 2217728..2217925 | - | 198 | WP_257110598.1 | hypothetical protein | - |
| NQZ97_RS10760 (NQZ97_10760) | 2217915..2218787 | - | 873 | WP_029176517.1 | 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA | - |
| NQZ97_RS10765 (NQZ97_10765) | 2218807..2219337 | - | 531 | WP_257110599.1 | DUF1697 domain-containing protein | - |
| NQZ97_RS10770 (NQZ97_10770) | 2219351..2219608 | - | 258 | WP_099832835.1 | Txe/YoeB family addiction module toxin | - |
| NQZ97_RS10775 (NQZ97_10775) | 2219610..2219870 | - | 261 | WP_044769049.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| NQZ97_RS10780 (NQZ97_10780) | 2219946..2220401 | - | 456 | WP_029173358.1 | 8-oxo-dGTP diphosphatase | - |
| NQZ97_RS10785 (NQZ97_10785) | 2220408..2220737 | - | 330 | WP_105130673.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NQZ97_RS10790 (NQZ97_10790) | 2220727..2221014 | - | 288 | WP_024381177.1 | hypothetical protein | Antitoxin |
| NQZ97_RS10795 (NQZ97_10795) | 2221112..2221480 | - | 369 | WP_024387381.1 | hypothetical protein | - |
| NQZ97_RS10800 (NQZ97_10800) | 2221473..2222042 | - | 570 | WP_105130675.1 | ribonuclease M5 | - |
| NQZ97_RS10805 (NQZ97_10805) | 2222026..2222808 | - | 783 | WP_105130674.1 | TatD family hydrolase | - |
| NQZ97_RS10810 (NQZ97_10810) | 2222912..2223049 | - | 138 | WP_043025166.1 | 50S ribosomal protein L34 | - |
| NQZ97_RS10815 (NQZ97_10815) | 2223217..2224212 | - | 996 | WP_002940330.1 | RNA-binding cell elongation regulator Jag/EloR | - |
| NQZ97_RS10820 (NQZ97_10820) | 2224232..2225044 | - | 813 | WP_002940331.1 | YidC/Oxa1 family membrane protein insertase | - |
| NQZ97_RS10825 (NQZ97_10825) | 2225028..2225387 | - | 360 | WP_004194560.1 | ribonuclease P protein component | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2217511..2217735 | 224 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12591.51 Da Isoelectric Point: 5.7541
>T253208 WP_105130673.1 NZ_CP102136:c2220737-2220408 [Streptococcus suis]
MEFESYSVILAPAVEKELVAIYAYFSEQFSEEIAKRRIGMIVEALESLQIFPERGFNADNRFGKQIDPPHLTRGYLIGKD
YIALYRVVENEVRVGHLFATKSDYVKLLK
MEFESYSVILAPAVEKELVAIYAYFSEQFSEEIAKRRIGMIVEALESLQIFPERGFNADNRFGKQIDPPHLTRGYLIGKD
YIALYRVVENEVRVGHLFATKSDYVKLLK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|