Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelB(antitoxin)
Location 2220408..2221014 Replicon chromosome
Accession NZ_CP102136
Organism Streptococcus suis strain M105052_S26

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag NQZ97_RS10785 Protein ID WP_105130673.1
Coordinates 2220408..2220737 (-) Length 110 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A075SKR5
Locus tag NQZ97_RS10790 Protein ID WP_024381177.1
Coordinates 2220727..2221014 (-) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NQZ97_RS10750 (NQZ97_10750) 2217378..2217735 - 358 Protein_2080 IS200/IS605 family transposase -
NQZ97_RS10755 (NQZ97_10755) 2217728..2217925 - 198 WP_257110598.1 hypothetical protein -
NQZ97_RS10760 (NQZ97_10760) 2217915..2218787 - 873 WP_029176517.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
NQZ97_RS10765 (NQZ97_10765) 2218807..2219337 - 531 WP_257110599.1 DUF1697 domain-containing protein -
NQZ97_RS10770 (NQZ97_10770) 2219351..2219608 - 258 WP_099832835.1 Txe/YoeB family addiction module toxin -
NQZ97_RS10775 (NQZ97_10775) 2219610..2219870 - 261 WP_044769049.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
NQZ97_RS10780 (NQZ97_10780) 2219946..2220401 - 456 WP_029173358.1 8-oxo-dGTP diphosphatase -
NQZ97_RS10785 (NQZ97_10785) 2220408..2220737 - 330 WP_105130673.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NQZ97_RS10790 (NQZ97_10790) 2220727..2221014 - 288 WP_024381177.1 hypothetical protein Antitoxin
NQZ97_RS10795 (NQZ97_10795) 2221112..2221480 - 369 WP_024387381.1 hypothetical protein -
NQZ97_RS10800 (NQZ97_10800) 2221473..2222042 - 570 WP_105130675.1 ribonuclease M5 -
NQZ97_RS10805 (NQZ97_10805) 2222026..2222808 - 783 WP_105130674.1 TatD family hydrolase -
NQZ97_RS10810 (NQZ97_10810) 2222912..2223049 - 138 WP_043025166.1 50S ribosomal protein L34 -
NQZ97_RS10815 (NQZ97_10815) 2223217..2224212 - 996 WP_002940330.1 RNA-binding cell elongation regulator Jag/EloR -
NQZ97_RS10820 (NQZ97_10820) 2224232..2225044 - 813 WP_002940331.1 YidC/Oxa1 family membrane protein insertase -
NQZ97_RS10825 (NQZ97_10825) 2225028..2225387 - 360 WP_004194560.1 ribonuclease P protein component -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 2217511..2217735 224


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-96)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 110 a.a.        Molecular weight: 12591.51 Da        Isoelectric Point: 5.7541

>T253208 WP_105130673.1 NZ_CP102136:c2220737-2220408 [Streptococcus suis]
MEFESYSVILAPAVEKELVAIYAYFSEQFSEEIAKRRIGMIVEALESLQIFPERGFNADNRFGKQIDPPHLTRGYLIGKD
YIALYRVVENEVRVGHLFATKSDYVKLLK

Download         Length: 330 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10897.49 Da        Isoelectric Point: 4.3472

>AT253208 WP_024381177.1 NZ_CP102136:c2221014-2220727 [Streptococcus suis]
MITIKKDAQVNFKTDSRLLEKAKEVFAMNQLDLTAGFNLFLQNIAVKNELPILTEEELEREELFLQLQKEIQENQQAIEA
GQGISLESVKEKYGI

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A075SKR5

References