Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 1245195..1245690 Replicon chromosome
Accession NZ_CP102136
Organism Streptococcus suis strain M105052_S26

Toxin (Protein)


Gene name relE Uniprot ID A0A116MI42
Locus tag NQZ97_RS06225 Protein ID WP_032510493.1
Coordinates 1245424..1245690 (+) Length 89 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A123SEG2
Locus tag NQZ97_RS06220 Protein ID WP_015646833.1
Coordinates 1245195..1245434 (+) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NQZ97_RS06195 (NQZ97_06195) 1240286..1241488 - 1203 WP_257110714.1 IS110 family transposase -
NQZ97_RS06200 (NQZ97_06200) 1241852..1241992 + 141 WP_032500004.1 hypothetical protein -
NQZ97_RS06205 (NQZ97_06205) 1242005..1242388 + 384 WP_043025610.1 NisI/SpaI family lantibiotic immunity lipoprotein -
NQZ97_RS06210 (NQZ97_06210) 1242405..1243157 + 753 WP_029173099.1 ABC transporter ATP-binding protein -
NQZ97_RS06215 (NQZ97_06215) 1243158..1245104 + 1947 WP_043025612.1 FtsX-like permease family protein -
NQZ97_RS06220 (NQZ97_06220) 1245195..1245434 + 240 WP_015646833.1 DUF6290 family protein Antitoxin
NQZ97_RS06225 (NQZ97_06225) 1245424..1245690 + 267 WP_032510493.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NQZ97_RS06230 (NQZ97_06230) 1245723..1246397 + 675 WP_231640460.1 response regulator transcription factor -
NQZ97_RS06235 (NQZ97_06235) 1246394..1247335 + 942 WP_043025617.1 sensor histidine kinase -
NQZ97_RS06240 (NQZ97_06240) 1247695..1248816 + 1122 WP_257110454.1 IS110 family transposase -
NQZ97_RS06245 (NQZ97_06245) 1249191..1250385 - 1195 Protein_1202 IS1182 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 1240286..1241488 1202
- flank IS/Tn - - 1249140..1250303 1163


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-87)

Antitoxin

Protein of unknown function DUF6290

(1-75)


Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10241.95 Da        Isoelectric Point: 10.4518

>T253206 WP_032510493.1 NZ_CP102136:1245424-1245690 [Streptococcus suis]
MSYKVILSAKAQKQIRKLDKTAASLILRYLYKHIDGCDNPRQYGKALTANRSGQWRYRIGNYRVIVSIEDDKLIVTALEV
GHRKEIYK

Download         Length: 267 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8879.09 Da        Isoelectric Point: 3.7832

>AT253206 WP_015646833.1 NZ_CP102136:1245195-1245434 [Streptococcus suis]
MAAITLKVSEQDKLFMQAMAKFEGVSLSELIRTKTLEALEDEYDARVADIAWAEYQEDLANGIEPITLEQMAEELGIEL

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A116MI42

Antitoxin

Source ID Structure
AlphaFold DB A0A123SEG2

References