Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/- |
| Location | 1182822..1183461 | Replicon | chromosome |
| Accession | NZ_CP102099 | ||
| Organism | Acinetobacter colistiniresistens strain C-214 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | N9PU81 |
| Locus tag | NQU59_RS05730 | Protein ID | WP_005238574.1 |
| Coordinates | 1183072..1183461 (+) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | N9PKX0 |
| Locus tag | NQU59_RS05725 | Protein ID | WP_005238573.1 |
| Coordinates | 1182822..1183079 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQU59_RS05700 (NQU59_05700) | 1177972..1178337 | + | 366 | WP_004641032.1 | 50S ribosomal protein L17 | - |
| NQU59_RS05705 (NQU59_05705) | 1178533..1179030 | + | 498 | WP_257065295.1 | GNAT family N-acetyltransferase | - |
| NQU59_RS05710 (NQU59_05710) | 1179285..1180775 | + | 1491 | WP_005238570.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| NQU59_RS05715 (NQU59_05715) | 1180902..1181402 | + | 501 | WP_257065296.1 | DUF2059 domain-containing protein | - |
| NQU59_RS05720 (NQU59_05720) | 1181462..1182634 | - | 1173 | WP_005238572.1 | acyl-CoA dehydrogenase family protein | - |
| NQU59_RS05725 (NQU59_05725) | 1182822..1183079 | + | 258 | WP_005238573.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
| NQU59_RS05730 (NQU59_05730) | 1183072..1183461 | + | 390 | WP_005238574.1 | hypothetical protein | Toxin |
| NQU59_RS05735 (NQU59_05735) | 1183667..1183876 | + | 210 | WP_005238575.1 | hypothetical protein | - |
| NQU59_RS05740 (NQU59_05740) | 1184236..1185351 | + | 1116 | WP_005238578.1 | hypothetical protein | - |
| NQU59_RS05745 (NQU59_05745) | 1185428..1185988 | + | 561 | WP_257065297.1 | rhombosortase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15706.77 Da Isoelectric Point: 10.2879
>T253196 WP_005238574.1 NZ_CP102099:1183072-1183461 [Acinetobacter colistiniresistens]
MAKHVFELQYSRFAFVLQLLLLIFLLSLLYALVSIGWWLLSLLGMTISWFVFLRQPQIRRFEYLDHQDCSFEFSDPTLKI
QRRQIVKILDHQLYIALYFSHKKHKPCIVWWDQLSYAQWKKLKIRAKLS
MAKHVFELQYSRFAFVLQLLLLIFLLSLLYALVSIGWWLLSLLGMTISWFVFLRQPQIRRFEYLDHQDCSFEFSDPTLKI
QRRQIVKILDHQLYIALYFSHKKHKPCIVWWDQLSYAQWKKLKIRAKLS
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|