Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 611406..612055 | Replicon | chromosome |
Accession | NZ_CP102099 | ||
Organism | Acinetobacter colistiniresistens strain C-214 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NQU59_RS02925 | Protein ID | WP_257064929.1 |
Coordinates | 611406..611825 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | S3TIA3 |
Locus tag | NQU59_RS02930 | Protein ID | WP_016653313.1 |
Coordinates | 611825..612055 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQU59_RS02890 (NQU59_02890) | 606426..606878 | - | 453 | WP_032879537.1 | hypothetical protein | - |
NQU59_RS02895 (NQU59_02895) | 607444..608331 | - | 888 | WP_257064925.1 | DMT family transporter | - |
NQU59_RS02900 (NQU59_02900) | 608475..609179 | - | 705 | WP_144583637.1 | DUF1003 domain-containing protein | - |
NQU59_RS02905 (NQU59_02905) | 609296..609535 | - | 240 | WP_257064927.1 | hypothetical protein | - |
NQU59_RS02910 (NQU59_02910) | 609684..610385 | - | 702 | WP_257064928.1 | hypothetical protein | - |
NQU59_RS02915 (NQU59_02915) | 610429..611004 | - | 576 | WP_257066129.1 | DUF4126 domain-containing protein | - |
NQU59_RS02920 (NQU59_02920) | 611132..611275 | - | 144 | WP_004637424.1 | zinc ribbon-containing protein | - |
NQU59_RS02925 (NQU59_02925) | 611406..611825 | - | 420 | WP_257064929.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NQU59_RS02930 (NQU59_02930) | 611825..612055 | - | 231 | WP_016653313.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NQU59_RS02935 (NQU59_02935) | 612267..614873 | - | 2607 | WP_257064934.1 | Fe/S-dependent 2-methylisocitrate dehydratase AcnD | - |
NQU59_RS02940 (NQU59_02940) | 614873..616030 | - | 1158 | WP_005240547.1 | 2-methylcitrate synthase | - |
NQU59_RS02945 (NQU59_02945) | 616149..617033 | - | 885 | WP_257064935.1 | methylisocitrate lyase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15988.15 Da Isoelectric Point: 6.3314
>T253195 WP_257064929.1 NZ_CP102099:c611825-611406 [Acinetobacter colistiniresistens]
MQAQYLLDTNICIYISKHQPESVRQHFEKHLPNRNILISVITLGELRFGAEKSQSKEKALKVIDEFTSMIQVAELDEDVA
DHYAQIRQALSSRSQIIGSNDLWLAAHARANNWVMVTNNEKEFLRVDGLRVENWVSNPL
MQAQYLLDTNICIYISKHQPESVRQHFEKHLPNRNILISVITLGELRFGAEKSQSKEKALKVIDEFTSMIQVAELDEDVA
DHYAQIRQALSSRSQIIGSNDLWLAAHARANNWVMVTNNEKEFLRVDGLRVENWVSNPL
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|