Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 1075251..1075779 Replicon chromosome
Accession NZ_CP102097
Organism Vibrio japonicus strain JCM 31412

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag NP165_RS18215 Protein ID WP_257085870.1
Coordinates 1075492..1075779 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A4Y8W958
Locus tag NP165_RS18210 Protein ID WP_017038856.1
Coordinates 1075251..1075502 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NP165_RS18175 (NP165_18175) 1070910..1071227 + 318 Protein_979 GNAT family N-acetyltransferase -
NP165_RS18180 (NP165_18180) 1071364..1072137 + 774 WP_257085895.1 aminoglycoside phosphotransferase family protein -
NP165_RS18185 (NP165_18185) 1072749..1073039 - 291 WP_005377002.1 type II toxin-antitoxin system RelE/ParE family toxin -
NP165_RS18190 (NP165_18190) 1073029..1073277 - 249 WP_040528287.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
NP165_RS18195 (NP165_18195) 1073334..1073420 + 87 WP_257086857.1 DUF3265 domain-containing protein -
NP165_RS18200 (NP165_18200) 1074027..1074449 + 423 WP_193297996.1 GNAT family N-acetyltransferase -
NP165_RS18205 (NP165_18205) 1074594..1075040 + 447 WP_053316779.1 GNAT family N-acetyltransferase -
NP165_RS18210 (NP165_18210) 1075251..1075502 + 252 WP_017038856.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NP165_RS18215 (NP165_18215) 1075492..1075779 + 288 WP_257085870.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NP165_RS18220 (NP165_18220) 1076081..1076302 + 222 WP_197942595.1 type II toxin-antitoxin system RelE/ParE family toxin -
NP165_RS18225 (NP165_18225) 1076299..1076583 + 285 WP_069502211.1 NadS family protein -
NP165_RS18230 (NP165_18230) 1077725..1077814 + 90 WP_074190930.1 DUF3265 domain-containing protein -
NP165_RS18235 (NP165_18235) 1078109..1079062 - 954 WP_257085860.1 IS1595 family transposase -
NP165_RS18240 (NP165_18240) 1079404..1080315 - 912 WP_248419187.1 toll/interleukin-1 receptor domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 1069952..1070905 953
- inside IScluster/Tn - - 1078109..1091425 13316
- inside Integron - - 1009525..1078214 68689
- inside Integron - - 1079284..1084924 5640


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(11-70)


Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11076.08 Da        Isoelectric Point: 10.5817

>T253192 WP_257085870.1 NZ_CP102097:1075492-1075779 [Vibrio japonicus]
MTYRLKFLPAAKKEWSKLAPPIQSQFKKKLKERLENPHVPSSKLRGYDSVYKIKLRTAGYRLAYEVIDDEIVVYVLAIGK
RDKDAVYKKLASRFA

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9155.34 Da        Isoelectric Point: 3.9840

>AT253192 WP_017038856.1 NZ_CP102097:1075251-1075502 [Vibrio japonicus]
MRQVLADCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEFLMDMLDDYELAKLVESRRGELSEAVEVDI
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A4Y8W958

References