Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 1072749..1073277 | Replicon | chromosome |
Accession | NZ_CP102097 | ||
Organism | Vibrio japonicus strain JCM 31412 |
Toxin (Protein)
Gene name | relE | Uniprot ID | K5TRR0 |
Locus tag | NP165_RS18185 | Protein ID | WP_005377002.1 |
Coordinates | 1072749..1073039 (-) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A377J6M1 |
Locus tag | NP165_RS18190 | Protein ID | WP_040528287.1 |
Coordinates | 1073029..1073277 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP165_RS18155 (NP165_18155) | 1068226..1068579 | + | 354 | WP_257085893.1 | hypothetical protein | - |
NP165_RS18160 (NP165_18160) | 1068740..1069075 | + | 336 | WP_023585733.1 | hypothetical protein | - |
NP165_RS18165 (NP165_18165) | 1069249..1069683 | + | 435 | WP_257085894.1 | GNAT family N-acetyltransferase | - |
NP165_RS18170 (NP165_18170) | 1069952..1070905 | + | 954 | WP_257085860.1 | IS1595 family transposase | - |
NP165_RS18175 (NP165_18175) | 1070910..1071227 | + | 318 | Protein_979 | GNAT family N-acetyltransferase | - |
NP165_RS18180 (NP165_18180) | 1071364..1072137 | + | 774 | WP_257085895.1 | aminoglycoside phosphotransferase family protein | - |
NP165_RS18185 (NP165_18185) | 1072749..1073039 | - | 291 | WP_005377002.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NP165_RS18190 (NP165_18190) | 1073029..1073277 | - | 249 | WP_040528287.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NP165_RS18195 (NP165_18195) | 1073334..1073420 | + | 87 | WP_257086857.1 | DUF3265 domain-containing protein | - |
NP165_RS18200 (NP165_18200) | 1074027..1074449 | + | 423 | WP_193297996.1 | GNAT family N-acetyltransferase | - |
NP165_RS18205 (NP165_18205) | 1074594..1075040 | + | 447 | WP_053316779.1 | GNAT family N-acetyltransferase | - |
NP165_RS18210 (NP165_18210) | 1075251..1075502 | + | 252 | WP_017038856.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
NP165_RS18215 (NP165_18215) | 1075492..1075779 | + | 288 | WP_257085870.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
NP165_RS18220 (NP165_18220) | 1076081..1076302 | + | 222 | WP_197942595.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
NP165_RS18225 (NP165_18225) | 1076299..1076583 | + | 285 | WP_069502211.1 | NadS family protein | - |
NP165_RS18230 (NP165_18230) | 1077725..1077814 | + | 90 | WP_074190930.1 | DUF3265 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1069952..1070905 | 953 | |
- | inside | IScluster/Tn | - | - | 1078109..1091425 | 13316 | |
- | inside | Integron | - | - | 1009525..1078214 | 68689 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11261.25 Da Isoelectric Point: 10.5932
>T253191 WP_005377002.1 NZ_CP102097:c1073039-1072749 [Vibrio japonicus]
MTYKLDFKKSALKEWKKLGSTLQQQFKKKLIERLDNPHVPASKLSGADNMYKIKLRQSGYRLVYKVEDDVIIVTVLAVGK
RERSDVYRKAMKRLDD
MTYKLDFKKSALKEWKKLGSTLQQQFKKKLIERLDNPHVPASKLSGADNMYKIKLRQSGYRLVYKVEDDVIIVTVLAVGK
RERSDVYRKAMKRLDD
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A347UR03 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A377J6M1 |