Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafN(antitoxin)
Location 1030262..1030827 Replicon chromosome
Accession NZ_CP102097
Organism Vibrio japonicus strain JCM 31412

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag NP165_RS17875 Protein ID WP_257085869.1
Coordinates 1030540..1030827 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A4P8FZQ1
Locus tag NP165_RS17870 Protein ID WP_025527476.1
Coordinates 1030262..1030543 (+) Length 94 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NP165_RS17840 (NP165_17840) 1026015..1026107 + 93 WP_078555105.1 DUF3265 domain-containing protein -
NP165_RS17845 (NP165_17845) 1026783..1028003 + 1221 WP_086610534.1 hypothetical protein -
NP165_RS17850 (NP165_17850) 1028134..1028541 + 408 WP_257085866.1 OsmC family protein -
NP165_RS17855 (NP165_17855) 1028677..1029105 + 429 WP_257085867.1 hypothetical protein -
NP165_RS17860 (NP165_17860) 1029249..1029620 + 372 WP_257085868.1 hypothetical protein -
NP165_RS17865 (NP165_17865) 1029617..1029733 + 117 WP_257086856.1 DUF3265 domain-containing protein -
NP165_RS17870 (NP165_17870) 1030262..1030543 + 282 WP_025527476.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NP165_RS17875 (NP165_17875) 1030540..1030827 + 288 WP_257085869.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NP165_RS17880 (NP165_17880) 1030998..1031561 + 564 WP_203531032.1 pyridoxamine 5'-phosphate oxidase family protein -
NP165_RS17885 (NP165_17885) 1031794..1032045 + 252 WP_017038856.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
NP165_RS17890 (NP165_17890) 1032035..1032322 + 288 WP_257085870.1 type II toxin-antitoxin system RelE/ParE family toxin -
NP165_RS17895 (NP165_17895) 1032471..1033028 + 558 WP_257085871.1 hypothetical protein -
NP165_RS17900 (NP165_17900) 1033031..1033108 + 78 Protein_924 DUF3265 domain-containing protein -
NP165_RS17905 (NP165_17905) 1033263..1033580 + 318 WP_029801295.1 antibiotic biosynthesis monooxygenase -
NP165_RS17910 (NP165_17910) 1033722..1034177 + 456 WP_257085872.1 GNAT family N-acetyltransferase -
NP165_RS17915 (NP165_17915) 1034314..1034718 + 405 WP_257085873.1 DUF1801 domain-containing protein -
NP165_RS17920 (NP165_17920) 1034867..1035379 + 513 WP_257085874.1 GNAT family N-acetyltransferase -
NP165_RS17925 (NP165_17925) 1035394..1035456 + 63 WP_079749016.1 DUF3265 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integron - - 1009525..1078214 68689


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-88)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(9-74)


Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 10965.58 Da        Isoelectric Point: 5.1098

>T253188 WP_257085869.1 NZ_CP102097:1030540-1030827 [Vibrio japonicus]
MKVVWSPLALQKLGDAAEFISLDNSSAAEKWVNEVFDKTELLGSMPEMGRFVPELPHTNYREIIFGHYRIIYSLSHEIRV
LTVRNCRQILSEDDV

Download         Length: 288 bp

Antitoxin


Download         Length: 94 a.a.        Molecular weight: 10412.93 Da        Isoelectric Point: 5.8719

>AT253188 WP_025527476.1 NZ_CP102097:1030262-1030543 [Vibrio japonicus]
MSRIHFDQDIQPLSEFRAGVASYIKQINETRRPLVITQRGKGVAVVLDVAEYEAMQEKIELLEEMRTAEAQLASGLGVSN
EDARAQVLGRIKK

Download         Length: 282 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A4P8FZQ1

References