Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 1886622..1887237 | Replicon | chromosome |
| Accession | NZ_CP102094 | ||
| Organism | Streptococcus suis strain 12RC1 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | NQZ84_RS09195 | Protein ID | WP_024401942.1 |
| Coordinates | 1886622..1886957 (-) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A075SJ65 |
| Locus tag | NQZ84_RS09200 | Protein ID | WP_024381089.1 |
| Coordinates | 1886950..1887237 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQZ84_RS09180 (NQZ84_09180) | 1882576..1883436 | - | 861 | WP_044676837.1 | GNAT family N-acetyltransferase | - |
| NQZ84_RS09185 (NQZ84_09185) | 1883480..1884097 | - | 618 | WP_024400199.1 | serine O-acetyltransferase | - |
| NQZ84_RS09190 (NQZ84_09190) | 1884151..1886370 | - | 2220 | WP_257047465.1 | polyribonucleotide nucleotidyltransferase | - |
| NQZ84_RS09195 (NQZ84_09195) | 1886622..1886957 | - | 336 | WP_024401942.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NQZ84_RS09200 (NQZ84_09200) | 1886950..1887237 | - | 288 | WP_024381089.1 | XRE family transcriptional regulator | Antitoxin |
| NQZ84_RS09205 (NQZ84_09205) | 1887560..1887829 | - | 270 | WP_002938849.1 | 30S ribosomal protein S15 | - |
| NQZ84_RS09210 (NQZ84_09210) | 1888034..1889311 | - | 1278 | WP_044677860.1 | solute carrier family 23 protein | - |
| NQZ84_RS09215 (NQZ84_09215) | 1889530..1890003 | - | 474 | WP_024395336.1 | hypothetical protein | - |
| NQZ84_RS09220 (NQZ84_09220) | 1889984..1890202 | - | 219 | WP_014638668.1 | helix-turn-helix transcriptional regulator | - |
| NQZ84_RS09225 (NQZ84_09225) | 1890348..1890857 | - | 510 | WP_029171081.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12700.73 Da Isoelectric Point: 9.1847
>T253185 WP_024401942.1 NZ_CP102094:c1886957-1886622 [Streptococcus suis]
MDKYQVNLPLAIYEELAGIRSYISEELKSPDAADKKIQELIAGLRSLEIFPERGFNVDERSKKGPLVPGHLTRGLPIKKD
YIAIYNIDEAQKVVNVRYLVASKSDYMRLFK
MDKYQVNLPLAIYEELAGIRSYISEELKSPDAADKKIQELIAGLRSLEIFPERGFNVDERSKKGPLVPGHLTRGLPIKKD
YIAIYNIDEAQKVVNVRYLVASKSDYMRLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|