Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 1537417..1538086 | Replicon | chromosome |
Accession | NZ_CP102094 | ||
Organism | Streptococcus suis strain 12RC1 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | G7SGM1 |
Locus tag | NQZ84_RS07505 | Protein ID | WP_014637653.1 |
Coordinates | 1537904..1538086 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | G7SGM2 |
Locus tag | NQZ84_RS07500 | Protein ID | WP_014637654.1 |
Coordinates | 1537417..1537866 (-) | Length | 150 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQZ84_RS07485 (NQZ84_07485) | 1533112..1535004 | - | 1893 | WP_044676989.1 | C69 family dipeptidase | - |
NQZ84_RS07490 (NQZ84_07490) | 1535197..1536057 | - | 861 | WP_257048907.1 | SAM-dependent methyltransferase TehB | - |
NQZ84_RS07495 (NQZ84_07495) | 1536213..1537256 | + | 1044 | WP_044680980.1 | Zn-dependent alcohol dehydrogenase | - |
NQZ84_RS07500 (NQZ84_07500) | 1537417..1537866 | - | 450 | WP_014637654.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
NQZ84_RS07505 (NQZ84_07505) | 1537904..1538086 | - | 183 | WP_014637653.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
NQZ84_RS07510 (NQZ84_07510) | 1538980..1539837 | - | 858 | WP_014637651.1 | ABC transporter ATP-binding protein | - |
NQZ84_RS07515 (NQZ84_07515) | 1539839..1540522 | - | 684 | WP_172058408.1 | hypothetical protein | - |
NQZ84_RS07520 (NQZ84_07520) | 1540925..1541392 | - | 468 | WP_014637647.1 | SsrA-binding protein SmpB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6653.87 Da Isoelectric Point: 10.8207
>T253184 WP_014637653.1 NZ_CP102094:c1538086-1537904 [Streptococcus suis]
MPMTQKEMVKLLTAHGWTKTKGGKGSHVKLEKAGERPITIPHGEINKYTERGIKKQAGLL
MPMTQKEMVKLLTAHGWTKTKGGKGSHVKLEKAGERPITIPHGEINKYTERGIKKQAGLL
Download Length: 183 bp
Antitoxin
Download Length: 150 a.a. Molecular weight: 16664.69 Da Isoelectric Point: 3.9458
>AT253184 WP_014637654.1 NZ_CP102094:c1537866-1537417 [Streptococcus suis]
MLVTYPALFYFDDTDGANAPYFVTFPDFEYSATQGEDMADAMAMASDWLGMNLADYIENGRDIPTPSSINTLSLVDNNPF
RNEDFEMVYDSSKSFISMVMVDVAKYLGSQEPVKKTLTIPRWADTLGRELGLNFSQTLTDAIADKKIHA
MLVTYPALFYFDDTDGANAPYFVTFPDFEYSATQGEDMADAMAMASDWLGMNLADYIENGRDIPTPSSINTLSLVDNNPF
RNEDFEMVYDSSKSFISMVMVDVAKYLGSQEPVKKTLTIPRWADTLGRELGLNFSQTLTDAIADKKIHA
Download Length: 450 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|