253181

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 2006612..2007087 Replicon chromosome
Accession NZ_CP102089
Organism Staphylococcus capitis subsp. capitis strain H17

Toxin (Protein)


Gene name TsaT Uniprot ID A0A1J4E6X5
Locus tag NF392_RS09630 Protein ID WP_002433387.1
Coordinates 2006902..2007087 (+) Length 62 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID A0A1J4E704
Locus tag NF392_RS09625 Protein ID WP_023350634.1
Coordinates 2006612..2006869 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NF392_RS09590 2001866..2002585 - 720 WP_023350630.1 type I 3-dehydroquinate dehydratase -
NF392_RS09595 2002755..2003177 + 423 WP_023350631.1 organic hydroperoxide resistance protein -
NF392_RS09600 2003586..2004092 + 507 WP_002433370.1 GNAT family N-acetyltransferase -
NF392_RS09605 2004273..2004890 + 618 WP_023350632.1 LysE/ArgO family amino acid transporter -
NF392_RS09610 2004946..2005530 - 585 WP_023350633.1 histidine phosphatase family protein -
NF392_RS09615 2005742..2005978 + 237 WP_002433110.1 hypothetical protein -
NF392_RS09620 2005970..2006173 - 204 WP_002432976.1 sterile alpha motif-like domain-containing protein -
NF392_RS09625 2006612..2006869 + 258 WP_023350634.1 hypothetical protein Antitoxin
NF392_RS09630 2006902..2007087 + 186 WP_002433387.1 hypothetical protein Toxin
NF392_RS09635 2007279..2007863 + 585 WP_023350635.1 lipoprotein N-acylation protein LnsA -
NF392_RS09640 2007926..2008159 - 234 WP_002433190.1 hypothetical protein -
NF392_RS09645 2008293..2008898 - 606 WP_023350636.1 GNAT family N-acetyltransferase -
NF392_RS09650 2009079..2009825 + 747 WP_023350637.1 poly-gamma-glutamate hydrolase family protein -
NF392_RS09655 2009945..2010229 + 285 WP_023350638.1 hypothetical protein -
NF392_RS09660 2010253..2010477 + 225 WP_002433282.1 hypothetical protein -
NF392_RS09665 2010786..2011520 - 735 WP_049307381.1 SGNH/GDSL hydrolase family protein -
NF392_RS09670 2011645..2011845 - 201 WP_002433447.1 cold-shock protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 62 a.a.        Molecular weight: 7022.71 Da        Isoelectric Point: 9.7844

>T253181 WP_002433387.1 NZ_CP102089:2006902-2007087 [Staphylococcus capitis subsp. capitis]
VSLHFQILLWLAIIFIVAGAIILTIMLKTKKEERKESYLGFTVIFLIFGFAMLIYTLIFGL

Download         Length: 186 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9786.89 Da        Isoelectric Point: 3.6988

>AT253181 WP_023350634.1 NZ_CP102089:2006612-2006869 [Staphylococcus capitis subsp. capitis]
MKIFSINVINILLTILFIAFNVLITYNANVDNQLWLIPGLCICGVALFTSLIIAIIYTDLLSEIIFFINIVLALYYIYPI
FYDFL

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1J4E6X5

Antitoxin

Source ID Structure
AlphaFold DB A0A1J4E704

References