Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/MazF(toxin)
Location 860700..861223 Replicon chromosome
Accession NZ_CP102089
Organism Staphylococcus capitis subsp. capitis strain H17

Toxin (Protein)


Gene name mazF Uniprot ID A0A1J4E8Y2
Locus tag NF392_RS04020 Protein ID WP_002435799.1
Coordinates 860867..861223 (+) Length 119 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A1J4E747
Locus tag NF392_RS04015 Protein ID WP_002435513.1
Coordinates 860700..860870 (+) Length 57 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NF392_RS03990 856527..857006 + 480 WP_023351370.1 PH domain-containing protein -
NF392_RS03995 856999..858498 + 1500 WP_030063298.1 PH domain-containing protein -
NF392_RS04000 858491..858991 + 501 WP_260832877.1 PH domain-containing protein -
NF392_RS04005 859040..859396 + 357 WP_002435510.1 holo-ACP synthase -
NF392_RS04010 859463..860611 + 1149 WP_023351373.1 alanine racemase -
NF392_RS04015 860700..860870 + 171 WP_002435513.1 type II toxin-antitoxin system antitoxin MazE Antitoxin
NF392_RS04020 860867..861223 + 357 WP_002435799.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
NF392_RS04025 861602..862603 + 1002 WP_030063302.1 PP2C family protein-serine/threonine phosphatase -
NF392_RS04030 862705..863031 + 327 WP_002435753.1 anti-sigma factor antagonist -
NF392_RS04035 863033..863512 + 480 WP_002435518.1 anti-sigma B factor RsbW -
NF392_RS04040 863487..864257 + 771 WP_002435824.1 RNA polymerase sigma factor SigB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(1-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 119 a.a.        Molecular weight: 13327.44 Da        Isoelectric Point: 9.8770

>T253176 WP_002435799.1 NZ_CP102089:860867-861223 [Staphylococcus capitis subsp. capitis]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSESKMKEVDNALDISLGLHNFDHQ

Download         Length: 357 bp

Antitoxin


Download         Length: 57 a.a.        Molecular weight: 6263.87 Da        Isoelectric Point: 4.0121

>AT253176 WP_002435513.1 NZ_CP102089:860700-860870 [Staphylococcus capitis subsp. capitis]
MLSFNQSRSHSLEQSLKEGYAQMADLNLSLATEAFPIECEACDCNETYLTSNSKNE

Download         Length: 171 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1J4E8Y2

Antitoxin

Source ID Structure
AlphaFold DB A0A1J4E747

References