Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/MazF(toxin)
Location 1642417..1642940 Replicon chromosome
Accession NZ_CP102087
Organism Staphylococcus capitis subsp. capitis strain K1-2-2-23

Toxin (Protein)


Gene name mazF Uniprot ID A0A1J4E8Y2
Locus tag NF398_RS08035 Protein ID WP_002435799.1
Coordinates 1642417..1642773 (-) Length 119 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A1J4E747
Locus tag NF398_RS08040 Protein ID WP_002435513.1
Coordinates 1642770..1642940 (-) Length 57 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NF398_RS08015 1639383..1640153 - 771 WP_002435824.1 RNA polymerase sigma factor SigB -
NF398_RS08020 1640128..1640607 - 480 WP_002435518.1 anti-sigma B factor RsbW -
NF398_RS08025 1640609..1640935 - 327 WP_002435753.1 anti-sigma factor antagonist -
NF398_RS08030 1641037..1642038 - 1002 WP_030063302.1 PP2C family protein-serine/threonine phosphatase -
NF398_RS08035 1642417..1642773 - 357 WP_002435799.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
NF398_RS08040 1642770..1642940 - 171 WP_002435513.1 type II toxin-antitoxin system antitoxin MazE Antitoxin
NF398_RS08045 1643029..1644177 - 1149 WP_023351373.1 alanine racemase -
NF398_RS08050 1644244..1644600 - 357 WP_002435510.1 holo-ACP synthase -
NF398_RS08055 1644649..1645149 - 501 WP_023351372.1 PH domain-containing protein -
NF398_RS08060 1645142..1646641 - 1500 WP_030063298.1 PH domain-containing protein -
NF398_RS08065 1646634..1647113 - 480 WP_023351370.1 PH domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(1-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 119 a.a.        Molecular weight: 13327.44 Da        Isoelectric Point: 9.8770

>T253171 WP_002435799.1 NZ_CP102087:c1642773-1642417 [Staphylococcus capitis subsp. capitis]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSESKMKEVDNALDISLGLHNFDHQ

Download         Length: 357 bp

Antitoxin


Download         Length: 57 a.a.        Molecular weight: 6263.87 Da        Isoelectric Point: 4.0121

>AT253171 WP_002435513.1 NZ_CP102087:c1642940-1642770 [Staphylococcus capitis subsp. capitis]
MLSFNQSRSHSLEQSLKEGYAQMADLNLSLATEAFPIECEACDCNETYLTSNSKNE

Download         Length: 171 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1J4E8Y2

Antitoxin

Source ID Structure
AlphaFold DB A0A1J4E747

References