Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_XRE(antitoxin)
Location 622229..623031 Replicon chromosome
Accession NZ_CP102087
Organism Staphylococcus capitis subsp. capitis strain K1-2-2-23

Toxin (Protein)


Gene name - Uniprot ID -
Locus tag NF398_RS03045 Protein ID WP_023350564.1
Coordinates 622229..622690 (-) Length 154 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID -
Locus tag NF398_RS03050 Protein ID WP_002469947.1
Coordinates 622702..623031 (-) Length 110 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NF398_RS03005 617311..618297 + 987 WP_023350570.1 lipoate--protein ligase -
NF398_RS03010 618378..618596 - 219 WP_023350569.1 IDEAL domain-containing protein -
NF398_RS03015 618816..619391 + 576 Protein_577 competence protein ComK -
NF398_RS03030 619903..620964 - 1062 WP_023350567.1 tyrosine-type recombinase/integrase -
NF398_RS03035 621024..621671 - 648 WP_049399292.1 hypothetical protein -
NF398_RS03040 621686..622210 - 525 WP_023350565.1 Ltp family lipoprotein -
NF398_RS03045 622229..622690 - 462 WP_023350564.1 ImmA/IrrE family metallo-endopeptidase Toxin
NF398_RS03050 622702..623031 - 330 WP_002469947.1 helix-turn-helix transcriptional regulator Antitoxin
NF398_RS03055 623225..623464 + 240 WP_049399294.1 helix-turn-helix transcriptional regulator -
NF398_RS03060 623480..624436 + 957 WP_049307539.1 ParB N-terminal domain-containing protein -
NF398_RS03065 624433..625203 + 771 WP_023350560.1 ParB N-terminal domain-containing protein -
NF398_RS03070 625286..625462 + 177 WP_023350559.1 hypothetical protein -
NF398_RS03075 625552..625650 + 99 Protein_587 hypothetical protein -
NF398_RS03080 625676..625852 - 177 WP_023350557.1 hypothetical protein -
NF398_RS03085 625935..626129 + 195 WP_023350556.1 hypothetical protein -
NF398_RS03090 626231..626398 + 168 WP_023350555.1 hypothetical protein -
NF398_RS03095 626402..626614 + 213 WP_002436465.1 DUF771 domain-containing protein -
NF398_RS03100 627092..627310 + 219 WP_023350553.1 hypothetical protein -
NF398_RS03105 627332..627613 + 282 WP_023350552.1 hypothetical protein -
NF398_RS03110 627579..627800 + 222 WP_023350551.1 DUF2483 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 619903..665602 45699


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

IrrE N-terminal-like domain

(17-119)

Antitoxin

Cro/C1-type helix-turn-helix domain

(10-65)


Sequences

Toxin        


Download         Length: 154 a.a.        Molecular weight: 18252.82 Da        Isoelectric Point: 5.8259

>T253167 WP_023350564.1 NZ_CP102087:c622690-622229 [Staphylococcus capitis subsp. capitis]
MGLYEKMLIEHDYIEIRETDVMPNDLHGLWLGDLILIKRNLSETRKAEVLYEELAHHKLTYGNILDQSKDINRKFENYAR
RYGYEAALPLRIIVEAHNYGVNNLYELAEYVQLSEEHVLEILNHYKNKYGIGTHYGEYLITFDPLRVFKYKEI

Download         Length: 462 bp

Antitoxin


Download         Length: 110 a.a.        Molecular weight: 12713.28 Da        Isoelectric Point: 6.2406

>AT253167 WP_002469947.1 NZ_CP102087:c623031-622702 [Staphylococcus capitis subsp. capitis]
MRNNDEIITIIKSAMKEQDMSLSELARRVGVAKSAVSRYLNLTREFPLNRSEDFAKALSISTEYLLGFDKSEQQHEQPQH
RAAHLEGELTDDEWQRVLDYADFIRSKRK

Download         Length: 330 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References