Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 496483..496958 Replicon chromosome
Accession NZ_CP102087
Organism Staphylococcus capitis subsp. capitis strain K1-2-2-23

Toxin (Protein)


Gene name TsaT Uniprot ID A0A1J4E6X5
Locus tag NF398_RS02410 Protein ID WP_002433387.1
Coordinates 496483..496668 (-) Length 62 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID A0A1J4E704
Locus tag NF398_RS02415 Protein ID WP_023350634.1
Coordinates 496701..496958 (-) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NF398_RS02370 491725..491925 + 201 WP_002433447.1 cold-shock protein -
NF398_RS02375 492050..492784 + 735 WP_049307381.1 SGNH/GDSL hydrolase family protein -
NF398_RS02380 493093..493317 - 225 WP_002433282.1 hypothetical protein -
NF398_RS02385 493341..493625 - 285 WP_023350638.1 hypothetical protein -
NF398_RS02390 493745..494491 - 747 WP_023350637.1 poly-gamma-glutamate hydrolase family protein -
NF398_RS02395 494672..495277 + 606 WP_023350636.1 GNAT family N-acetyltransferase -
NF398_RS02400 495411..495644 + 234 WP_002433190.1 hypothetical protein -
NF398_RS02405 495707..496291 - 585 WP_023350635.1 lipoprotein N-acylation protein LnsA -
NF398_RS02410 496483..496668 - 186 WP_002433387.1 hypothetical protein Toxin
NF398_RS02415 496701..496958 - 258 WP_023350634.1 hypothetical protein Antitoxin
NF398_RS02420 497397..497600 + 204 WP_002432976.1 sterile alpha motif-like domain-containing protein -
NF398_RS02425 497592..497828 - 237 WP_002433110.1 hypothetical protein -
NF398_RS02430 498040..498624 + 585 WP_023350633.1 histidine phosphatase family protein -
NF398_RS02435 498680..499297 - 618 WP_023350632.1 LysE/ArgO family amino acid transporter -
NF398_RS02440 499478..499984 - 507 WP_002433370.1 GNAT family N-acetyltransferase -
NF398_RS02445 500393..500815 - 423 WP_023350631.1 organic hydroperoxide resistance protein -
NF398_RS02450 500985..501704 + 720 WP_023350630.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 62 a.a.        Molecular weight: 7022.71 Da        Isoelectric Point: 9.7844

>T253166 WP_002433387.1 NZ_CP102087:c496668-496483 [Staphylococcus capitis subsp. capitis]
VSLHFQILLWLAIIFIVAGAIILTIMLKTKKEERKESYLGFTVIFLIFGFAMLIYTLIFGL

Download         Length: 186 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9786.89 Da        Isoelectric Point: 3.6988

>AT253166 WP_023350634.1 NZ_CP102087:c496958-496701 [Staphylococcus capitis subsp. capitis]
MKIFSINVINILLTILFIAFNVLITYNANVDNQLWLIPGLCICGVALFTSLIIAIIYTDLLSEIIFFINIVLALYYIYPI
FYDFL

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1J4E6X5

Antitoxin

Source ID Structure
AlphaFold DB A0A1J4E704

References