Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 3890421..3891022 | Replicon | chromosome |
| Accession | NZ_CP102086 | ||
| Organism | Proteus mirabilis strain MN029 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | - |
| Locus tag | NOO60_RS17850 | Protein ID | WP_283533744.1 |
| Coordinates | 3890639..3891022 (+) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | A0A1Z1SPN9 |
| Locus tag | NOO60_RS17845 | Protein ID | WP_004246496.1 |
| Coordinates | 3890421..3890642 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NOO60_RS17820 | 3886255..3886713 | + | 459 | WP_004246490.1 | dUTP diphosphatase | - |
| NOO60_RS17825 | 3886833..3887438 | + | 606 | WP_004246491.1 | nucleoid occlusion factor SlmA | - |
| NOO60_RS17830 | 3887757..3888401 | - | 645 | WP_283533743.1 | orotate phosphoribosyltransferase | - |
| NOO60_RS17835 | 3888483..3889199 | - | 717 | WP_004249760.1 | ribonuclease PH | - |
| NOO60_RS17840 | 3889326..3890189 | + | 864 | WP_004249947.1 | YicC/YloC family endoribonuclease | - |
| NOO60_RS17845 | 3890421..3890642 | + | 222 | WP_004246496.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NOO60_RS17850 | 3890639..3891022 | + | 384 | WP_283533744.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| NOO60_RS17855 | 3891429..3891743 | + | 315 | WP_041701465.1 | helix-turn-helix transcriptional regulator | - |
| NOO60_RS17860 | 3891756..3892994 | + | 1239 | WP_020946511.1 | HipA domain-containing protein | - |
| NOO60_RS17865 | 3893351..3894250 | - | 900 | WP_063108742.1 | N-acetylmuramic acid 6-phosphate etherase | - |
| NOO60_RS17870 | 3894359..3895096 | + | 738 | WP_004249950.1 | tetratricopeptide repeat protein | - |
| NOO60_RS17875 | 3895192..3895650 | - | 459 | WP_004249766.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14511.55 Da Isoelectric Point: 8.5289
>T253165 WP_283533744.1 NZ_CP102086:3890639-3891022 [Proteus mirabilis]
MIWVSAQEVIAFHDRILQHFLGVAGMSDPGRAEALIYRVQNRKHYEGITDVFERAATYWVAIARGHIFNDGNKRTAFFVT
MTFLYRNGIRIRDTGNMLENLTVEAATGEKTVDQLAKHLQNLVEKTN
MIWVSAQEVIAFHDRILQHFLGVAGMSDPGRAEALIYRVQNRKHYEGITDVFERAATYWVAIARGHIFNDGNKRTAFFVT
MTFLYRNGIRIRDTGNMLENLTVEAATGEKTVDQLAKHLQNLVEKTN
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|