Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-MqsA |
Location | 232343..233042 | Replicon | chromosome |
Accession | NZ_CP102086 | ||
Organism | Proteus mirabilis strain MN029 |
Toxin (Protein)
Gene name | relE | Uniprot ID | B4EZ96 |
Locus tag | NOO60_RS01090 | Protein ID | WP_004249093.1 |
Coordinates | 232656..233042 (-) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | B4EZ97 |
Locus tag | NOO60_RS01085 | Protein ID | WP_004246828.1 |
Coordinates | 232343..232663 (-) | Length | 107 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOO60_RS01055 | 227473..227748 | - | 276 | WP_004246820.1 | DNA-directed RNA polymerase subunit omega | - |
NOO60_RS01060 | 227803..228426 | - | 624 | WP_004246821.1 | guanylate kinase | - |
NOO60_RS01065 | 228728..229345 | - | 618 | WP_004246822.1 | trimeric intracellular cation channel family protein | - |
NOO60_RS01070 | 229482..230768 | + | 1287 | WP_017827115.1 | DUF3748 domain-containing protein | - |
NOO60_RS01075 | 230983..231867 | + | 885 | WP_012368526.1 | endonuclease/exonuclease/phosphatase family protein | - |
NOO60_RS01080 | 231860..232294 | + | 435 | WP_020946391.1 | hypothetical protein | - |
NOO60_RS01085 | 232343..232663 | - | 321 | WP_004246828.1 | helix-turn-helix domain-containing protein | Antitoxin |
NOO60_RS01090 | 232656..233042 | - | 387 | WP_004249093.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NOO60_RS01095 | 233204..235276 | - | 2073 | WP_041701373.1 | glycine--tRNA ligase subunit beta | - |
NOO60_RS01100 | 235286..236191 | - | 906 | WP_004246832.1 | glycine--tRNA ligase subunit alpha | - |
NOO60_RS01105 | 236442..237023 | + | 582 | WP_283533771.1 | DNA-3-methyladenine glycosylase I | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14294.64 Da Isoelectric Point: 10.0642
>T253162 WP_004249093.1 NZ_CP102086:c233042-232656 [Proteus mirabilis]
MVIYKTKMFKNSFKKITLTNAELIAIATEVLAGQFEADLGGGVIKKRACIQGKGKSSGIRTIIFYKQGNNLFFADGWKKS
SLSSKKTKEITDDELESYKDLAKDLFNANQNKIDKMIALGLLTEVKYD
MVIYKTKMFKNSFKKITLTNAELIAIATEVLAGQFEADLGGGVIKKRACIQGKGKSSGIRTIIFYKQGNNLFFADGWKKS
SLSSKKTKEITDDELESYKDLAKDLFNANQNKIDKMIALGLLTEVKYD
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|