Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 1418224..1418834 | Replicon | chromosome |
| Accession | NZ_CP102085 | ||
| Organism | Mycoavidus sp. SF9855 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | NQD60_RS05495 | Protein ID | WP_257099987.1 |
| Coordinates | 1418224..1418529 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NQD60_RS05500 | Protein ID | WP_257099988.1 |
| Coordinates | 1418526..1418834 (+) | Length | 103 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQD60_RS05465 (NQD60_05465) | 1414397..1414936 | - | 540 | WP_257099981.1 | hypothetical protein | - |
| NQD60_RS05470 (NQD60_05470) | 1415107..1416261 | - | 1155 | WP_257099982.1 | hypothetical protein | - |
| NQD60_RS05475 (NQD60_05475) | 1416423..1416785 | - | 363 | WP_257099983.1 | hypothetical protein | - |
| NQD60_RS05480 (NQD60_05480) | 1416782..1417279 | - | 498 | WP_257099984.1 | hypothetical protein | - |
| NQD60_RS05485 (NQD60_05485) | 1417325..1417765 | - | 441 | WP_257099985.1 | DUF4054 domain-containing protein | - |
| NQD60_RS05490 (NQD60_05490) | 1417767..1418123 | - | 357 | WP_257099986.1 | hypothetical protein | - |
| NQD60_RS05495 (NQD60_05495) | 1418224..1418529 | + | 306 | WP_257099987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NQD60_RS05500 (NQD60_05500) | 1418526..1418834 | + | 309 | WP_257099988.1 | putative addiction module antidote protein | Antitoxin |
| NQD60_RS05505 (NQD60_05505) | 1418835..1419929 | - | 1095 | WP_257099989.1 | DUF2184 domain-containing protein | - |
| NQD60_RS05510 (NQD60_05510) | 1419940..1420440 | - | 501 | WP_257099990.1 | hypothetical protein | - |
| NQD60_RS05515 (NQD60_05515) | 1420445..1421674 | - | 1230 | WP_257099991.1 | DUF2213 domain-containing protein | - |
| NQD60_RS05520 (NQD60_05520) | 1421671..1422531 | - | 861 | WP_257099992.1 | phage minor head protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1373956..1436841 | 62885 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11633.28 Da Isoelectric Point: 9.9572
>T253160 WP_257099987.1 NZ_CP102085:1418224-1418529 [Mycoavidus sp. SF9855]
MIEIIQSTTFSAWLSDLKDRQARARIQVRLDRIRNGNFGDVKPIGNGLSEARIHYGNGYRLYFLQHKKELVVLLCGGDKS
TQSRDIEQAKRIAQEWTESIL
MIEIIQSTTFSAWLSDLKDRQARARIQVRLDRIRNGNFGDVKPIGNGLSEARIHYGNGYRLYFLQHKKELVVLLCGGDKS
TQSRDIEQAKRIAQEWTESIL
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|