Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 1343470..1344070 | Replicon | chromosome |
Accession | NZ_CP102085 | ||
Organism | Mycoavidus sp. SF9855 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | NQD60_RS05135 | Protein ID | WP_257099917.1 |
Coordinates | 1343771..1344070 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | NQD60_RS05130 | Protein ID | WP_257099916.1 |
Coordinates | 1343470..1343769 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQD60_RS05090 (NQD60_05090) | 1339121..1339372 | - | 252 | WP_257099908.1 | hypothetical protein | - |
NQD60_RS05095 (NQD60_05095) | 1339402..1339602 | + | 201 | WP_257099909.1 | hypothetical protein | - |
NQD60_RS05100 (NQD60_05100) | 1339627..1340460 | + | 834 | WP_257099910.1 | DNA adenine methylase | - |
NQD60_RS05105 (NQD60_05105) | 1340500..1340700 | + | 201 | WP_257099911.1 | hypothetical protein | - |
NQD60_RS05110 (NQD60_05110) | 1340715..1341569 | + | 855 | WP_257099912.1 | hypothetical protein | - |
NQD60_RS05115 (NQD60_05115) | 1341556..1342209 | + | 654 | WP_257099913.1 | DUF6475 domain-containing protein | - |
NQD60_RS05120 (NQD60_05120) | 1342242..1342685 | + | 444 | WP_257099914.1 | RusA family crossover junction endodeoxyribonuclease | - |
NQD60_RS05125 (NQD60_05125) | 1342802..1343206 | + | 405 | WP_257099915.1 | hypothetical protein | - |
NQD60_RS05130 (NQD60_05130) | 1343470..1343769 | - | 300 | WP_257099916.1 | putative addiction module antidote protein | Antitoxin |
NQD60_RS05135 (NQD60_05135) | 1343771..1344070 | - | 300 | WP_257099917.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NQD60_RS05140 (NQD60_05140) | 1344458..1344871 | + | 414 | WP_257099918.1 | terminase small subunit protein | - |
NQD60_RS05145 (NQD60_05145) | 1344822..1346357 | + | 1536 | WP_257099919.1 | phage terminase large subunit | - |
NQD60_RS05150 (NQD60_05150) | 1346469..1347875 | + | 1407 | WP_257099920.1 | DUF1073 domain-containing protein | - |
NQD60_RS05155 (NQD60_05155) | 1347961..1348668 | + | 708 | WP_257099921.1 | phage minor head protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1323143..1384924 | 61781 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11273.90 Da Isoelectric Point: 10.2636
>T253159 WP_257099917.1 NZ_CP102085:c1344070-1343771 [Mycoavidus sp. SF9855]
MAIELKQTEAFRKWRVRLKDERARALIASRLDRLAYGHAGDAEPVGRGISELRIHYGPGYRVYFQKRGSTIIVLLCGGNK
STQADDIKKAQRLADEWSE
MAIELKQTEAFRKWRVRLKDERARALIASRLDRLAYGHAGDAEPVGRGISELRIHYGPGYRVYFQKRGSTIIVLLCGGNK
STQADDIKKAQRLADEWSE
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|