Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 26855..27380 Replicon plasmid p5589-mcr-8
Accession NZ_CP102079
Organism Klebsiella pneumoniae strain 5589

Toxin (Protein)


Gene name ccdB Uniprot ID D4HQE7
Locus tag NOV87_RS27310 Protein ID WP_013023785.1
Coordinates 27075..27380 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID W8V2V6
Locus tag NOV87_RS27305 Protein ID WP_001568025.1
Coordinates 26855..27073 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NOV87_RS27285 (NOV87_27285) 22102..23070 + 969 WP_256946455.1 IS5 family transposase -
NOV87_RS27290 (NOV87_27290) 23542..24333 - 792 WP_221928726.1 ribbon-helix-helix domain-containing protein -
NOV87_RS27295 (NOV87_27295) 24516..25544 - 1029 WP_032445668.1 Abi family protein -
NOV87_RS27300 (NOV87_27300) 25705..26286 - 582 WP_072310991.1 hypothetical protein -
NOV87_RS27305 (NOV87_27305) 26855..27073 + 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NOV87_RS27310 (NOV87_27310) 27075..27380 + 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB Toxin
NOV87_RS27315 (NOV87_27315) 27549..27944 + 396 WP_017899885.1 hypothetical protein -
NOV87_RS27320 (NOV87_27320) 27971..28294 + 324 WP_004197641.1 hypothetical protein -
NOV87_RS27325 (NOV87_27325) 28291..29307 + 1017 WP_118842534.1 hypothetical protein -
NOV87_RS27330 (NOV87_27330) 29505..30290 + 786 WP_046664219.1 site-specific integrase -
NOV87_RS27335 (NOV87_27335) 30739..31494 + 756 WP_001568031.1 replication initiation protein RepE -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid mcr-8 / floR / tet(A) / mph(A) / sul1 / qnrB91 / qacE / aadA16 / dfrA27 / ARR-3 / aac(6')-Ib-cr - 1..137567 137567
- flank IS/Tn mcr-8 - 16045..23070 7025


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11615.30 Da        Isoelectric Point: 6.4672

>T253158 WP_013023785.1 NZ_CP102079:27075-27380 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8392.34 Da        Isoelectric Point: 4.7405

>AT253158 WP_001568025.1 NZ_CP102079:26855-27073 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRSERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4ZZW6

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4ZZP8

References