Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 26855..27380 | Replicon | plasmid p5589-mcr-8 |
| Accession | NZ_CP102079 | ||
| Organism | Klebsiella pneumoniae strain 5589 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | D4HQE7 |
| Locus tag | NOV87_RS27310 | Protein ID | WP_013023785.1 |
| Coordinates | 27075..27380 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | W8V2V6 |
| Locus tag | NOV87_RS27305 | Protein ID | WP_001568025.1 |
| Coordinates | 26855..27073 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NOV87_RS27285 (NOV87_27285) | 22102..23070 | + | 969 | WP_256946455.1 | IS5 family transposase | - |
| NOV87_RS27290 (NOV87_27290) | 23542..24333 | - | 792 | WP_221928726.1 | ribbon-helix-helix domain-containing protein | - |
| NOV87_RS27295 (NOV87_27295) | 24516..25544 | - | 1029 | WP_032445668.1 | Abi family protein | - |
| NOV87_RS27300 (NOV87_27300) | 25705..26286 | - | 582 | WP_072310991.1 | hypothetical protein | - |
| NOV87_RS27305 (NOV87_27305) | 26855..27073 | + | 219 | WP_001568025.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| NOV87_RS27310 (NOV87_27310) | 27075..27380 | + | 306 | WP_013023785.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| NOV87_RS27315 (NOV87_27315) | 27549..27944 | + | 396 | WP_017899885.1 | hypothetical protein | - |
| NOV87_RS27320 (NOV87_27320) | 27971..28294 | + | 324 | WP_004197641.1 | hypothetical protein | - |
| NOV87_RS27325 (NOV87_27325) | 28291..29307 | + | 1017 | WP_118842534.1 | hypothetical protein | - |
| NOV87_RS27330 (NOV87_27330) | 29505..30290 | + | 786 | WP_046664219.1 | site-specific integrase | - |
| NOV87_RS27335 (NOV87_27335) | 30739..31494 | + | 756 | WP_001568031.1 | replication initiation protein RepE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | mcr-8 / floR / tet(A) / mph(A) / sul1 / qnrB91 / qacE / aadA16 / dfrA27 / ARR-3 / aac(6')-Ib-cr | - | 1..137567 | 137567 | |
| - | flank | IS/Tn | mcr-8 | - | 16045..23070 | 7025 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11615.30 Da Isoelectric Point: 6.4672
>T253158 WP_013023785.1 NZ_CP102079:27075-27380 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4ZZW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4ZZP8 |