Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 158501..159144 | Replicon | plasmid p5589-CTX-M-55 |
| Accession | NZ_CP102078 | ||
| Organism | Klebsiella pneumoniae strain 5589 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | B1LRW4 |
| Locus tag | NOV87_RS26490 | Protein ID | WP_001044768.1 |
| Coordinates | 158501..158917 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D2WFK3 |
| Locus tag | NOV87_RS26495 | Protein ID | WP_001261287.1 |
| Coordinates | 158914..159144 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NOV87_RS26475 (NOV87_26475) | 155000..155590 | - | 591 | WP_000194575.1 | hypothetical protein | - |
| NOV87_RS26480 (NOV87_26480) | 155590..155847 | - | 258 | WP_000343085.1 | hypothetical protein | - |
| NOV87_RS26485 (NOV87_26485) | 156201..158339 | + | 2139 | WP_000350638.1 | AAA family ATPase | - |
| NOV87_RS26490 (NOV87_26490) | 158501..158917 | - | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NOV87_RS26495 (NOV87_26495) | 158914..159144 | - | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NOV87_RS26500 (NOV87_26500) | 159440..159730 | + | 291 | WP_000111771.1 | hypothetical protein | - |
| NOV87_RS26505 (NOV87_26505) | 159720..160619 | + | 900 | WP_000963206.1 | nucleotide-binding protein | - |
| NOV87_RS26510 (NOV87_26510) | 160669..162894 | - | 2226 | WP_000698737.1 | P-loop NTPase fold protein | - |
| NOV87_RS26515 (NOV87_26515) | 162896..163984 | - | 1089 | WP_000952217.1 | transcriptional repressor PifC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aadA2 / cmlA1 / ant(3'')-Ia / sul3 / aac(3)-IVa / aph(4)-Ia / aph(6)-Id / aph(3'')-Ib / fosA3 / blaTEM-1B / blaCTX-M-55 / mph(E) / msr(E) | - | 1..290720 | 290720 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T253157 WP_001044768.1 NZ_CP102078:c158917-158501 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A606Q844 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QFC4 |