Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3974979..3975598 | Replicon | chromosome |
| Accession | NZ_CP102077 | ||
| Organism | Klebsiella pneumoniae strain 5589 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | NOV87_RS19370 | Protein ID | WP_002892050.1 |
| Coordinates | 3975380..3975598 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | NOV87_RS19365 | Protein ID | WP_002892066.1 |
| Coordinates | 3974979..3975353 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NOV87_RS19355 (3970131) | 3970131..3971324 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NOV87_RS19360 (3971347) | 3971347..3974493 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| NOV87_RS19365 (3974979) | 3974979..3975353 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| NOV87_RS19370 (3975380) | 3975380..3975598 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| NOV87_RS19375 (3975761) | 3975761..3976327 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| NOV87_RS19380 (3976299) | 3976299..3976439 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| NOV87_RS19385 (3976460) | 3976460..3976930 | + | 471 | WP_020802585.1 | YlaC family protein | - |
| NOV87_RS19390 (3976905) | 3976905..3978356 | - | 1452 | WP_004183206.1 | PLP-dependent aminotransferase family protein | - |
| NOV87_RS19395 (3978457) | 3978457..3979155 | + | 699 | WP_023287311.1 | GNAT family protein | - |
| NOV87_RS19400 (3979152) | 3979152..3979292 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| NOV87_RS19405 (3979292) | 3979292..3979555 | - | 264 | WP_032432663.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T253151 WP_002892050.1 NZ_CP102077:3975380-3975598 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT253151 WP_002892066.1 NZ_CP102077:3974979-3975353 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |