Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3974979..3975598 Replicon chromosome
Accession NZ_CP102077
Organism Klebsiella pneumoniae strain 5589

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NOV87_RS19370 Protein ID WP_002892050.1
Coordinates 3975380..3975598 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NOV87_RS19365 Protein ID WP_002892066.1
Coordinates 3974979..3975353 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NOV87_RS19355 (3970131) 3970131..3971324 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NOV87_RS19360 (3971347) 3971347..3974493 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NOV87_RS19365 (3974979) 3974979..3975353 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NOV87_RS19370 (3975380) 3975380..3975598 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NOV87_RS19375 (3975761) 3975761..3976327 + 567 WP_002892030.1 maltose O-acetyltransferase -
NOV87_RS19380 (3976299) 3976299..3976439 - 141 WP_004147370.1 hypothetical protein -
NOV87_RS19385 (3976460) 3976460..3976930 + 471 WP_020802585.1 YlaC family protein -
NOV87_RS19390 (3976905) 3976905..3978356 - 1452 WP_004183206.1 PLP-dependent aminotransferase family protein -
NOV87_RS19395 (3978457) 3978457..3979155 + 699 WP_023287311.1 GNAT family protein -
NOV87_RS19400 (3979152) 3979152..3979292 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NOV87_RS19405 (3979292) 3979292..3979555 - 264 WP_032432663.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T253151 WP_002892050.1 NZ_CP102077:3975380-3975598 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT253151 WP_002892066.1 NZ_CP102077:3974979-3975353 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References