Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1472317..1473053 | Replicon | chromosome |
| Accession | NZ_CP102077 | ||
| Organism | Klebsiella pneumoniae strain 5589 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A4S4Y1H2 |
| Locus tag | NOV87_RS07275 | Protein ID | WP_032433360.1 |
| Coordinates | 1472571..1473053 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | NOV87_RS07270 | Protein ID | WP_003026799.1 |
| Coordinates | 1472317..1472583 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NOV87_RS07245 (1467963) | 1467963..1469102 | + | 1140 | WP_032433368.1 | mannitol dehydrogenase | - |
| NOV87_RS07250 (1469131) | 1469131..1469793 | + | 663 | WP_032433366.1 | dihydroxyacetone kinase subunit DhaL | - |
| NOV87_RS07255 (1469777) | 1469777..1470781 | + | 1005 | WP_032433364.1 | dihydroxyacetone kinase subunit DhaK | - |
| NOV87_RS07260 (1470799) | 1470799..1471431 | + | 633 | WP_032433362.1 | 3-hexulose-6-phosphate synthase | - |
| NOV87_RS07265 (1471441) | 1471441..1472004 | + | 564 | WP_032433361.1 | 6-phospho-3-hexuloisomerase | - |
| NOV87_RS07270 (1472317) | 1472317..1472583 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| NOV87_RS07275 (1472571) | 1472571..1473053 | + | 483 | WP_032433360.1 | GNAT family N-acetyltransferase | Toxin |
| NOV87_RS07280 (1473414) | 1473414..1474013 | - | 600 | WP_032432064.1 | helix-turn-helix transcriptional regulator | - |
| NOV87_RS07285 (1474226) | 1474226..1475170 | - | 945 | WP_077254249.1 | fimbrial protein | - |
| NOV87_RS07290 (1475182) | 1475182..1475760 | - | 579 | WP_032432061.1 | type 1 fimbrial protein | - |
| NOV87_RS07295 (1475764) | 1475764..1476504 | - | 741 | WP_050597964.1 | molecular chaperone | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1440262..1483996 | 43734 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17421.02 Da Isoelectric Point: 9.6047
>T253145 WP_032433360.1 NZ_CP102077:1472571-1473053 [Klebsiella pneumoniae]
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4S4Y1H2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |