Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 1455626..1456269 | Replicon | chromosome |
Accession | NZ_CP102077 | ||
Organism | Klebsiella pneumoniae strain 5589 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | A0A4S8C081 |
Locus tag | NOV87_RS07180 | Protein ID | WP_032433387.1 |
Coordinates | 1455853..1456269 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | Q84A07 |
Locus tag | NOV87_RS07175 | Protein ID | WP_001261276.1 |
Coordinates | 1455626..1455856 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOV87_RS07160 (1450648) | 1450648..1451735 | + | 1088 | Protein_1397 | transcriptional regulator | - |
NOV87_RS07165 (1451738) | 1451738..1453978 | + | 2241 | WP_045326788.1 | P-loop NTPase fold protein | - |
NOV87_RS07170 (1454506) | 1454506..1455321 | - | 816 | WP_032433388.1 | hypothetical protein | - |
NOV87_RS07175 (1455626) | 1455626..1455856 | + | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NOV87_RS07180 (1455853) | 1455853..1456269 | + | 417 | WP_032433387.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NOV87_RS07185 (1456425) | 1456425..1457405 | + | 981 | WP_032433385.1 | hypothetical protein | - |
NOV87_RS07190 (1457600) | 1457600..1459171 | - | 1572 | WP_256946424.1 | AAA family ATPase | - |
NOV87_RS07195 (1459490) | 1459490..1459738 | + | 249 | WP_032433382.1 | hypothetical protein | - |
NOV87_RS07200 (1459797) | 1459797..1460315 | + | 519 | WP_045326794.1 | hypothetical protein | - |
NOV87_RS07205 (1460346) | 1460346..1460837 | + | 492 | WP_032433378.1 | hypothetical protein | - |
NOV87_RS07210 (1460897) | 1460897..1461100 | + | 204 | WP_032433376.1 | HHA domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1440262..1483996 | 43734 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14974.43 Da Isoelectric Point: 7.8921
>T253144 WP_032433387.1 NZ_CP102077:1455853-1456269 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4S8C081 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A387K023 |