Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 4484..5621 | Replicon | plasmid pJF3A-4253-4 |
Accession | NZ_CP102073 | ||
Organism | Enterococcus faecalis strain JF3A-4253 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | - |
Locus tag | NP948_RS14830 | Protein ID | WP_256969069.1 |
Coordinates | 4484..5347 (-) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | R2XCR7 |
Locus tag | NP948_RS14835 | Protein ID | WP_000301765.1 |
Coordinates | 5349..5621 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP948_RS14815 | 1281..2255 | - | 975 | WP_256969065.1 | Dam family site-specific DNA-(adenine-N6)-methyltransferase | - |
NP948_RS14820 | 2255..3487 | - | 1233 | WP_256969066.1 | DNA adenine methylase | - |
NP948_RS14825 | 3736..4420 | + | 685 | WP_256969067.1 | IS6 family transposase | - |
NP948_RS14830 | 4484..5347 | - | 864 | WP_256969069.1 | zeta toxin family protein | Toxin |
NP948_RS14835 | 5349..5621 | - | 273 | WP_000301765.1 | antitoxin | Antitoxin |
NP948_RS14840 | 5638..5853 | - | 216 | WP_001835296.1 | peptide-binding protein | - |
NP948_RS14845 | 5945..6841 | - | 897 | WP_002387620.1 | ParA family protein | - |
NP948_RS14850 | 6930..9074 | - | 2145 | WP_256969070.1 | type IA DNA topoisomerase | - |
NP948_RS14855 | 9074..9691 | - | 618 | WP_128712832.1 | recombinase family protein | - |
NP948_RS14860 | 9705..9875 | - | 171 | WP_164742224.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | Cfr(D) / poxtA / fexA | - | 1..21806 | 21806 | |
- | flank | IS/Tn | - | - | 3959..4420 | 461 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32440.98 Da Isoelectric Point: 6.6610
>T253140 WP_256969069.1 NZ_CP102073:c5347-4484 [Enterococcus faecalis]
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVIAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKLESLQPPTPPIPKIPKLPGL
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVIAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKLESLQPPTPPIPKIPKLPGL
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|