Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Xre-MNT/HTH_26(antitoxin) |
| Location | 22753..23861 | Replicon | plasmid pJF3A-4253-2 |
| Accession | NZ_CP102071 | ||
| Organism | Enterococcus faecalis strain JF3A-4253 | ||
Toxin (Protein)
| Gene name | MNTss | Uniprot ID | R3JIN1 |
| Locus tag | NP948_RS14295 | Protein ID | WP_000233000.1 |
| Coordinates | 22753..23622 (-) | Length | 290 a.a. |
Antitoxin (Protein)
| Gene name | Xress | Uniprot ID | - |
| Locus tag | NP948_RS14300 | Protein ID | WP_000205227.1 |
| Coordinates | 23637..23861 (-) | Length | 75 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP948_RS14260 | 17952..18323 | - | 372 | Protein_23 | transposase | - |
| NP948_RS14265 | 18551..19078 | - | 528 | WP_002294507.1 | phosphoribosyltransferase family protein | - |
| NP948_RS14270 | 19122..19874 | - | 753 | Protein_25 | aminoglycoside 6-adenylyltransferase | - |
| NP948_RS14275 | 20044..21483 | - | 1440 | WP_001028144.1 | aminoglycoside O-phosphotransferase APH(2'')-Ia | - |
| NP948_RS14280 | 21484..21876 | - | 393 | WP_000393259.1 | GNAT family N-acetyltransferase | - |
| NP948_RS14285 | 21895..22005 | - | 111 | Protein_28 | aminoglycoside 6-adenylyltransferase | - |
| NP948_RS14290 | 22038..22772 | - | 735 | WP_000662263.1 | class I SAM-dependent methyltransferase | - |
| NP948_RS14295 | 22753..23622 | - | 870 | WP_000233000.1 | nucleotidyltransferase domain-containing protein | Toxin |
| NP948_RS14300 | 23637..23861 | - | 225 | WP_000205227.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| NP948_RS14305 | 24004..25566 | - | 1563 | WP_000136908.1 | recombinase family protein | - |
| NP948_RS14310 | 25568..25984 | - | 417 | WP_000323438.1 | recombinase | - |
| NP948_RS14315 | 25985..26473 | - | 489 | WP_225582191.1 | DNA recombinase | - |
| NP948_RS14320 | 26793..27470 | - | 678 | Protein_35 | DNA topoisomerase | - |
| NP948_RS14325 | 27470..28087 | - | 618 | WP_002295591.1 | recombinase family protein | - |
| NP948_RS14330 | 28101..28271 | - | 171 | WP_000713595.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 290 a.a. Molecular weight: 32926.57 Da Isoelectric Point: 4.8781
>T253138 WP_000233000.1 NZ_CP102071:c23622-22753 [Enterococcus faecalis]
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
Download Length: 870 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|