Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ImmA-IrrE/HTH_26(antitoxin) |
| Location | 2372062..2372757 | Replicon | chromosome |
| Accession | NZ_CP102070 | ||
| Organism | Enterococcus faecalis strain JF3A-4253 | ||
Toxin (Protein)
| Gene name | IrrE | Uniprot ID | - |
| Locus tag | NP948_RS11655 | Protein ID | WP_104802092.1 |
| Coordinates | 2372413..2372757 (+) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | ImmA | Uniprot ID | - |
| Locus tag | NP948_RS11650 | Protein ID | WP_002373919.1 |
| Coordinates | 2372062..2372394 (+) | Length | 111 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP948_RS11590 (2367608) | 2367608..2368579 | - | 972 | WP_256968919.1 | RecT family recombinase | - |
| NP948_RS11595 (2368629) | 2368629..2368949 | + | 321 | WP_010707143.1 | hypothetical protein | - |
| NP948_RS11600 (2368968) | 2368968..2369279 | - | 312 | WP_229228118.1 | hypothetical protein | - |
| NP948_RS11605 (2369376) | 2369376..2369600 | - | 225 | WP_104802087.1 | hypothetical protein | - |
| NP948_RS11610 (2369597) | 2369597..2369896 | - | 300 | WP_002388460.1 | hypothetical protein | - |
| NP948_RS11615 (2369963) | 2369963..2370142 | - | 180 | WP_104802088.1 | hypothetical protein | - |
| NP948_RS11620 (2370177) | 2370177..2370446 | - | 270 | WP_002365131.1 | hypothetical protein | - |
| NP948_RS11625 (2370522) | 2370522..2370836 | + | 315 | WP_010776102.1 | hypothetical protein | - |
| NP948_RS11630 (2370817) | 2370817..2370945 | - | 129 | WP_010776103.1 | hypothetical protein | - |
| NP948_RS11635 (2371092) | 2371092..2371274 | + | 183 | WP_104802089.1 | hypothetical protein | - |
| NP948_RS11640 (2371266) | 2371266..2371568 | - | 303 | WP_104802090.1 | hypothetical protein | - |
| NP948_RS11645 (2371581) | 2371581..2371763 | - | 183 | WP_104802091.1 | hypothetical protein | - |
| NP948_RS11650 (2372062) | 2372062..2372394 | + | 333 | WP_002373919.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| NP948_RS11655 (2372413) | 2372413..2372757 | + | 345 | WP_104802092.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
| NP948_RS11660 (2372844) | 2372844..2373026 | + | 183 | WP_010817602.1 | hypothetical protein | - |
| NP948_RS11665 (2373028) | 2373028..2373675 | - | 648 | WP_104802093.1 | hypothetical protein | - |
| NP948_RS11670 (2373865) | 2373865..2374680 | + | 816 | Protein_2268 | site-specific integrase | - |
| NP948_RS11675 (2374791) | 2374791..2375045 | + | 255 | WP_256968920.1 | tyrosine-type recombinase/integrase | - |
| NP948_RS11680 (2375148) | 2375148..2375297 | - | 150 | WP_002356321.1 | 50S ribosomal protein L33 | - |
| NP948_RS11685 (2375423) | 2375423..2377558 | - | 2136 | WP_002362471.1 | penicillin-binding protein 2 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2341683..2374929 | 33246 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13626.61 Da Isoelectric Point: 5.6177
>T253123 WP_104802092.1 NZ_CP102070:2372413-2372757 [Enterococcus faecalis]
MKSIKELVEEYNVELVFTTLNKRACFDPTYGIIFVNQNLTPSEQEEAIYHELKHVKDHVDIMTLYKIPVFRSKMESEAEQ
YMFRSLIEKYEGQYNYSNVIAHYNLKMGQEVYLK
MKSIKELVEEYNVELVFTTLNKRACFDPTYGIIFVNQNLTPSEQEEAIYHELKHVKDHVDIMTLYKIPVFRSKMESEAEQ
YMFRSLIEKYEGQYNYSNVIAHYNLKMGQEVYLK
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|