Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ImmA-IrrE/HTH_26(antitoxin)
Location 2372062..2372757 Replicon chromosome
Accession NZ_CP102070
Organism Enterococcus faecalis strain JF3A-4253

Toxin (Protein)


Gene name IrrE Uniprot ID -
Locus tag NP948_RS11655 Protein ID WP_104802092.1
Coordinates 2372413..2372757 (+) Length 115 a.a.

Antitoxin (Protein)


Gene name ImmA Uniprot ID -
Locus tag NP948_RS11650 Protein ID WP_002373919.1
Coordinates 2372062..2372394 (+) Length 111 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NP948_RS11590 (2367608) 2367608..2368579 - 972 WP_256968919.1 RecT family recombinase -
NP948_RS11595 (2368629) 2368629..2368949 + 321 WP_010707143.1 hypothetical protein -
NP948_RS11600 (2368968) 2368968..2369279 - 312 WP_229228118.1 hypothetical protein -
NP948_RS11605 (2369376) 2369376..2369600 - 225 WP_104802087.1 hypothetical protein -
NP948_RS11610 (2369597) 2369597..2369896 - 300 WP_002388460.1 hypothetical protein -
NP948_RS11615 (2369963) 2369963..2370142 - 180 WP_104802088.1 hypothetical protein -
NP948_RS11620 (2370177) 2370177..2370446 - 270 WP_002365131.1 hypothetical protein -
NP948_RS11625 (2370522) 2370522..2370836 + 315 WP_010776102.1 hypothetical protein -
NP948_RS11630 (2370817) 2370817..2370945 - 129 WP_010776103.1 hypothetical protein -
NP948_RS11635 (2371092) 2371092..2371274 + 183 WP_104802089.1 hypothetical protein -
NP948_RS11640 (2371266) 2371266..2371568 - 303 WP_104802090.1 hypothetical protein -
NP948_RS11645 (2371581) 2371581..2371763 - 183 WP_104802091.1 hypothetical protein -
NP948_RS11650 (2372062) 2372062..2372394 + 333 WP_002373919.1 helix-turn-helix transcriptional regulator Antitoxin
NP948_RS11655 (2372413) 2372413..2372757 + 345 WP_104802092.1 ImmA/IrrE family metallo-endopeptidase Toxin
NP948_RS11660 (2372844) 2372844..2373026 + 183 WP_010817602.1 hypothetical protein -
NP948_RS11665 (2373028) 2373028..2373675 - 648 WP_104802093.1 hypothetical protein -
NP948_RS11670 (2373865) 2373865..2374680 + 816 Protein_2268 site-specific integrase -
NP948_RS11675 (2374791) 2374791..2375045 + 255 WP_256968920.1 tyrosine-type recombinase/integrase -
NP948_RS11680 (2375148) 2375148..2375297 - 150 WP_002356321.1 50S ribosomal protein L33 -
NP948_RS11685 (2375423) 2375423..2377558 - 2136 WP_002362471.1 penicillin-binding protein 2 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2341683..2374929 33246


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

IrrE N-terminal-like domain

(21-86)

Antitoxin

Cro/C1-type helix-turn-helix domain

(5-59)


Sequences

Toxin        


Download         Length: 115 a.a.        Molecular weight: 13626.61 Da        Isoelectric Point: 5.6177

>T253123 WP_104802092.1 NZ_CP102070:2372413-2372757 [Enterococcus faecalis]
MKSIKELVEEYNVELVFTTLNKRACFDPTYGIIFVNQNLTPSEQEEAIYHELKHVKDHVDIMTLYKIPVFRSKMESEAEQ
YMFRSLIEKYEGQYNYSNVIAHYNLKMGQEVYLK

Download         Length: 345 bp

Antitoxin


Download         Length: 111 a.a.        Molecular weight: 12734.28 Da        Isoelectric Point: 5.2423

>AT253123 WP_002373919.1 NZ_CP102070:2372062-2372394 [Enterococcus faecalis]
MNTYEIIKELTKRKKMSIRQLEITLGYSNGYFSKWKKVSPNSEGLQKVADYFNVSVDYLLGRTDNTKATDEKNSDDLDDV
LDNVMSFDGEPLDDHDREVIRAYLKGRFGK

Download         Length: 333 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References