Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 17756..18893 | Replicon | plasmid pJF3A-223-4 |
Accession | NZ_CP102068 | ||
Organism | Enterococcus faecalis strain JF3A-223 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | - |
Locus tag | NP947_RS14475 | Protein ID | WP_256969069.1 |
Coordinates | 18030..18893 (+) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | R2XCR7 |
Locus tag | NP947_RS14470 | Protein ID | WP_000301765.1 |
Coordinates | 17756..18028 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP947_RS14455 | 14615..16447 | + | 1833 | WP_256969963.1 | type IA DNA topoisomerase | - |
NP947_RS14460 | 16536..17432 | + | 897 | WP_002387620.1 | ParA family protein | - |
NP947_RS14465 | 17524..17739 | + | 216 | WP_001835296.1 | peptide-binding protein | - |
NP947_RS14470 | 17756..18028 | + | 273 | WP_000301765.1 | antitoxin | Antitoxin |
NP947_RS14475 | 18030..18893 | + | 864 | WP_256969069.1 | zeta toxin family protein | Toxin |
NP947_RS14485 | 19890..21122 | + | 1233 | WP_256969066.1 | DNA adenine methylase | - |
NP947_RS14490 | 21122..22096 | + | 975 | WP_256969065.1 | Dam family site-specific DNA-(adenine-N6)-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | fexA / poxtA / Cfr(D) | - | 1..26169 | 26169 | |
- | flank | IS/Tn | - | - | 18957..19418 | 461 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32440.98 Da Isoelectric Point: 6.6610
>T253119 WP_256969069.1 NZ_CP102068:18030-18893 [Enterococcus faecalis]
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVIAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKLESLQPPTPPIPKIPKLPGL
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVIAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKLESLQPPTPPIPKIPKLPGL
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|