253118

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 71101..71672 Replicon plasmid pJF3A-223-2
Accession NZ_CP102066
Organism Enterococcus faecalis strain JF3A-223

Toxin (Protein)


Gene name mazF Uniprot ID S4H3R9
Locus tag NP947_RS13945 Protein ID WP_010784114.1
Coordinates 71101..71442 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag NP947_RS13950 Protein ID WP_002362431.1
Coordinates 71442..71672 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NP947_RS13925 66500..67783 - 1284 WP_002405123.1 hypothetical protein -
NP947_RS13935 69184..69786 - 603 WP_002362434.1 Fic family protein -
NP947_RS13940 70051..70989 - 939 WP_002362433.1 hypothetical protein -
NP947_RS13945 71101..71442 - 342 WP_010784114.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
NP947_RS13950 71442..71672 - 231 WP_002362431.1 hypothetical protein Antitoxin
NP947_RS13955 71876..72496 + 621 WP_002367784.1 recombinase family protein -
NP947_RS13960 72486..72800 + 315 WP_002367785.1 hypothetical protein -
NP947_RS13965 72794..73000 + 207 WP_002367786.1 hypothetical protein -
NP947_RS13970 73160..73354 + 195 WP_002367787.1 hypothetical protein -
NP947_RS13975 73366..73557 + 192 WP_002367788.1 hypothetical protein -
NP947_RS13980 73727..73942 + 216 WP_002367791.1 leucocin A/sakacin P family class II bacteriocin -
NP947_RS13985 73943..74284 + 342 WP_002367792.1 bacteriocin immunity protein -
NP947_RS13990 74700..75218 + 519 WP_002367793.1 hypothetical protein -
NP947_RS13995 75166..75381 + 216 WP_002415356.1 hypothetical protein -
NP947_RS14000 75473..75559 + 87 WP_012881081.1 type I toxin-antitoxin system Fst family toxin -
NP947_RS14005 75816..76112 + 297 WP_002367795.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid cat / tet(L) / tet(M) / erm(B) - 1..80765 80765


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(7-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13270.47 Da        Isoelectric Point: 7.9750

>T253118 WP_010784114.1 NZ_CP102066:c71442-71101 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEYLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT253118 WP_002362431.1 NZ_CP102066:c71672-71442 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S4H3R9

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References