Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 2692321..2692892 | Replicon | chromosome |
Accession | NZ_CP102065 | ||
Organism | Enterococcus faecalis strain JF3A-223 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | NP947_RS13125 | Protein ID | WP_010710856.1 |
Coordinates | 2692321..2692662 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | R3JGB1 |
Locus tag | NP947_RS13130 | Protein ID | WP_002354773.1 |
Coordinates | 2692662..2692892 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP947_RS13120 (2688336) | 2688336..2691950 | - | 3615 | WP_002389470.1 | DNA-directed RNA polymerase subunit beta | - |
NP947_RS13125 (2692321) | 2692321..2692662 | - | 342 | WP_010710856.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NP947_RS13130 (2692662) | 2692662..2692892 | - | 231 | WP_002354773.1 | hypothetical protein | Antitoxin |
NP947_RS13135 (2693223) | 2693223..2693438 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
NP947_RS13140 (2693577) | 2693577..2694569 | + | 993 | WP_002394775.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
NP947_RS13145 (2694736) | 2694736..2695374 | - | 639 | WP_002378863.1 | lytic polysaccharide monooxygenase | - |
NP947_RS13150 (2696059) | 2696059..2697675 | + | 1617 | WP_010710855.1 | phosphatase PAP2/LCP family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13177.47 Da Isoelectric Point: 9.3988
>T253111 WP_010710856.1 NZ_CP102065:c2692662-2692321 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPIISTIKNIPTRYTLPDDIETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPIISTIKNIPTRYTLPDDIETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|