Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ImmA-IrrE/HTH_19(antitoxin)
Location 1709624..1710318 Replicon chromosome
Accession NZ_CP102065
Organism Enterococcus faecalis strain JF3A-223

Toxin (Protein)


Gene name IrrE Uniprot ID -
Locus tag NP947_RS08545 Protein ID WP_105194759.1
Coordinates 1709974..1710318 (+) Length 115 a.a.

Antitoxin (Protein)


Gene name ImmA Uniprot ID -
Locus tag NP947_RS08540 Protein ID WP_002364355.1
Coordinates 1709624..1709956 (+) Length 111 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NP947_RS08485 (1704743) 1704743..1704943 - 201 WP_057086713.1 hypothetical protein -
NP947_RS08490 (1704940) 1704940..1705083 - 144 WP_226088781.1 hypothetical protein -
NP947_RS08495 (1705152) 1705152..1706063 - 912 WP_105194763.1 YqaJ viral recombinase family protein -
NP947_RS08500 (1706076) 1706076..1706318 - 243 WP_010826713.1 hypothetical protein -
NP947_RS08505 (1706320) 1706320..1707516 - 1197 WP_016626781.1 DEAD/DEAH box helicase -
NP947_RS08510 (1707506) 1707506..1707799 - 294 WP_010826715.1 VRR-NUC domain-containing protein -
NP947_RS08515 (1707796) 1707796..1707996 - 201 WP_105194762.1 hypothetical protein -
NP947_RS08520 (1708211) 1708211..1708627 - 417 WP_226088780.1 hypothetical protein -
NP947_RS08525 (1708628) 1708628..1708807 - 180 WP_002395800.1 hypothetical protein -
NP947_RS08530 (1708814) 1708814..1709125 - 312 WP_105194760.1 hypothetical protein -
NP947_RS08535 (1709136) 1709136..1709312 - 177 WP_002364354.1 helix-turn-helix transcriptional regulator -
NP947_RS08540 (1709624) 1709624..1709956 + 333 WP_002364355.1 helix-turn-helix transcriptional regulator Antitoxin
NP947_RS08545 (1709974) 1709974..1710318 + 345 WP_105194759.1 ImmA/IrrE family metallo-endopeptidase Toxin
NP947_RS08550 (1710352) 1710352..1711080 + 729 WP_033918699.1 potassium channel family protein -
NP947_RS08555 (1711177) 1711177..1712325 + 1149 WP_105194837.1 site-specific integrase -
NP947_RS08560 (1712353) 1712353..1712796 - 444 WP_129992406.1 competence type IV pilus minor pilin ComGD -
NP947_RS08565 (1712793) 1712793..1713068 - 276 WP_002356991.1 competence type IV pilus major pilin ComGC -
NP947_RS08570 (1713068) 1713068..1714114 - 1047 WP_002369171.1 competence type IV pilus assembly protein ComGB -
NP947_RS08575 (1714071) 1714071..1715039 - 969 WP_010710572.1 competence type IV pilus ATPase ComGA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1676706..1731174 54468


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

IrrE N-terminal-like domain

(22-81)

Antitoxin

Cro/C1-type helix-turn-helix domain

(5-63)


Sequences

Toxin        


Download         Length: 115 a.a.        Molecular weight: 13707.58 Da        Isoelectric Point: 5.5339

>T253107 WP_105194759.1 NZ_CP102065:1709974-1710318 [Enterococcus faecalis]
MKSIKELVEEYEVELVFAPINKRACYEPSERIIFVNQNLSIEEQEESIFHEFKHVVSHSDYMELYKIPSFRNKMEAEADH
HMFKCLIEKHEGQFNYSNVVTHYNLKMGQETYLK

Download         Length: 345 bp

Antitoxin


Download         Length: 111 a.a.        Molecular weight: 12691.16 Da        Isoelectric Point: 4.6307

>AT253107 WP_002364355.1 NZ_CP102065:1709624-1709956 [Enterococcus faecalis]
MNLLERIKKLAKDRDVSIYQLEEEINIGRNTIYQWNKRTPSSDKLEAVANYFNVSVDYLLGRTENPNQAGAKPSDDLDEV
LDNVMSFDGEPLDDHDREVIRAYLKGRFGK

Download         Length: 333 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References