Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Xre-MNT/HTH_26(antitoxin) |
| Location | 1413623..1414731 | Replicon | chromosome |
| Accession | NZ_CP102065 | ||
| Organism | Enterococcus faecalis strain JF3A-223 | ||
Toxin (Protein)
| Gene name | MNTss | Uniprot ID | A0A193AUR0 |
| Locus tag | NP947_RS06965 | Protein ID | WP_002378351.1 |
| Coordinates | 1413623..1414492 (-) | Length | 290 a.a. |
Antitoxin (Protein)
| Gene name | Xress | Uniprot ID | - |
| Locus tag | NP947_RS06970 | Protein ID | WP_000205227.1 |
| Coordinates | 1414507..1414731 (-) | Length | 75 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP947_RS06945 (1409894) | 1409894..1411213 | - | 1320 | WP_002338419.1 | IS1380-like element ISSsu5 family transposase | - |
| NP947_RS06950 (1411441) | 1411441..1411842 | - | 402 | WP_002401582.1 | phosphoribosyltransferase family protein | - |
| NP947_RS06955 (1412012) | 1412012..1412875 | - | 864 | WP_002294505.1 | aminoglycoside nucleotidyltransferase ANT(6)-Ia | - |
| NP947_RS06960 (1412908) | 1412908..1413642 | - | 735 | WP_000662263.1 | class I SAM-dependent methyltransferase | - |
| NP947_RS06965 (1413623) | 1413623..1414492 | - | 870 | WP_002378351.1 | nucleotidyltransferase domain-containing protein | Toxin |
| NP947_RS06970 (1414507) | 1414507..1414731 | - | 225 | WP_000205227.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| NP947_RS06975 (1414874) | 1414874..1414960 | - | 87 | Protein_1339 | site-specific recombinase | - |
| NP947_RS06980 (1415149) | 1415149..1416450 | + | 1302 | Protein_1340 | ISL3 family transposase | - |
| NP947_RS06985 (1416759) | 1416759..1417562 | - | 804 | WP_002294514.1 | lincosamide nucleotidyltransferase Lnu(B) | - |
| NP947_RS06990 (1417616) | 1417616..1419100 | - | 1485 | WP_002294513.1 | ABC-F type ribosomal protection protein Lsa(E) | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | erm(B) / ant(6)-Ia / lnu(B) / lsa(E) / aph(3')-III / aac(6')-aph(2'') | - | 1242579..1465855 | 223276 | |
| - | inside | IScluster/Tn | erm(B) / ant(6)-Ia / lnu(B) / lsa(E) / aph(3')-III / aac(6')-aph(2'') | - | 1402240..1434253 | 32013 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 290 a.a. Molecular weight: 32912.50 Da Isoelectric Point: 4.7903
>T253106 WP_002378351.1 NZ_CP102065:c1414492-1413623 [Enterococcus faecalis]
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYNEVNEIVSEINNFLNEESSDERKQI
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYNEVNEIVSEINNFLNEESSDERKQI
Download Length: 870 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|