Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 1404058..1405195 | Replicon | chromosome |
Accession | NZ_CP102065 | ||
Organism | Enterococcus faecalis strain JF3A-223 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | - |
Locus tag | NP947_RS06900 | Protein ID | WP_002401483.1 |
Coordinates | 1404058..1404921 (-) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | R2XCR7 |
Locus tag | NP947_RS06905 | Protein ID | WP_000301765.1 |
Coordinates | 1404923..1405195 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP947_RS06870 (1399857) | 1399857..1400624 | - | 768 | WP_002357481.1 | ribonuclease HII | - |
NP947_RS06875 (1400626) | 1400626..1401477 | - | 852 | WP_002357480.1 | ribosome biogenesis GTPase YlqF | - |
NP947_RS06880 (1401753) | 1401753..1402184 | - | 432 | Protein_1320 | 2-dehydropantoate 2-reductase | - |
NP947_RS06885 (1402240) | 1402240..1402920 | - | 681 | WP_010713944.1 | IS6-like element IS1216 family transposase | - |
NP947_RS06890 (1402994) | 1402994..1403281 | - | 288 | Protein_1322 | DnaJ domain-containing protein | - |
NP947_RS06895 (1403301) | 1403301..1403618 | - | 318 | WP_002300567.1 | hypothetical protein | - |
NP947_RS06900 (1404058) | 1404058..1404921 | - | 864 | WP_002401483.1 | zeta toxin family protein | Toxin |
NP947_RS06905 (1404923) | 1404923..1405195 | - | 273 | WP_000301765.1 | antitoxin | Antitoxin |
NP947_RS06910 (1405212) | 1405212..1405427 | - | 216 | WP_001835296.1 | peptide-binding protein | - |
NP947_RS06915 (1405519) | 1405519..1406415 | - | 897 | WP_002326827.1 | ParA family protein | - |
NP947_RS06920 (1406518) | 1406518..1406778 | - | 261 | Protein_1328 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
NP947_RS06925 (1406948) | 1406948..1407685 | - | 738 | WP_002292226.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
NP947_RS06930 (1407810) | 1407810..1407905 | - | 96 | WP_001809736.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
NP947_RS06935 (1407974) | 1407974..1408096 | - | 123 | Protein_1331 | peptide-binding protein | - |
NP947_RS06940 (1408216) | 1408216..1409742 | - | 1527 | WP_025191980.1 | type IA DNA topoisomerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | erm(B) / ant(6)-Ia / lnu(B) / lsa(E) / aph(3')-III / aac(6')-aph(2'') | - | 1242579..1465855 | 223276 | |
- | inside | IScluster/Tn | erm(B) / ant(6)-Ia / lnu(B) / lsa(E) / aph(3')-III / aac(6')-aph(2'') | - | 1402240..1434253 | 32013 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32486.06 Da Isoelectric Point: 6.9965
>T253105 WP_002401483.1 NZ_CP102065:c1404921-1404058 [Enterococcus faecalis]
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAILEETQGNVIVIDNDTFKQQHPNFDELA
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSRLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMLQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGL
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAILEETQGNVIVIDNDTFKQQHPNFDELA
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSRLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMLQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGL
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|