Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4186825..4187443 | Replicon | chromosome |
| Accession | NZ_CP102061 | ||
| Organism | Escherichia coli strain C31 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | NP943_RS20335 | Protein ID | WP_001291435.1 |
| Coordinates | 4186825..4187043 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | NP943_RS20340 | Protein ID | WP_000344800.1 |
| Coordinates | 4187069..4187443 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP943_RS20300 (4182112) | 4182112..4182684 | + | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
| NP943_RS20305 (4182715) | 4182715..4183026 | - | 312 | WP_000409908.1 | MGMT family protein | - |
| NP943_RS20315 (4183405) | 4183405..4183758 | + | 354 | WP_000878135.1 | DUF1428 family protein | - |
| NP943_RS20320 (4183800) | 4183800..4185350 | - | 1551 | WP_001385227.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| NP943_RS20325 (4185514) | 4185514..4185984 | - | 471 | WP_000136192.1 | YlaC family protein | - |
| NP943_RS20330 (4186100) | 4186100..4186651 | - | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
| NP943_RS20335 (4186825) | 4186825..4187043 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| NP943_RS20340 (4187069) | 4187069..4187443 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| NP943_RS20345 (4187989) | 4187989..4191138 | - | 3150 | WP_001132478.1 | efflux RND transporter permease AcrB | - |
| NP943_RS20350 (4191161) | 4191161..4192354 | - | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T253093 WP_001291435.1 NZ_CP102061:c4187043-4186825 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT253093 WP_000344800.1 NZ_CP102061:c4187443-4187069 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |