Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 3736011..3736531 Replicon chromosome
Accession NZ_CP102061
Organism Escherichia coli strain C31

Toxin (Protein)


Gene name ccdB Uniprot ID A0A061KX66
Locus tag NP943_RS18180 Protein ID WP_001160964.1
Coordinates 3736247..3736531 (+) Length 95 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag NP943_RS18175 Protein ID WP_000125566.1
Coordinates 3736011..3736244 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NP943_RS18150 (3731084) 3731084..3731371 + 288 WP_000203744.1 ferredoxin-like protein FixX -
NP943_RS18155 (3731430) 3731430..3732761 + 1332 WP_001183209.1 MFS transporter -
NP943_RS18160 (3732869) 3732869..3733399 + 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
NP943_RS18165 (3733392) 3733392..3735254 + 1863 WP_000377106.1 glutathione-regulated potassium-efflux system protein KefC -
NP943_RS18170 (3735446) 3735446..3735925 + 480 WP_000624375.1 type 3 dihydrofolate reductase -
NP943_RS18175 (3736011) 3736011..3736244 + 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
NP943_RS18180 (3736247) 3736247..3736531 + 285 WP_001160964.1 CcdB family protein Toxin
NP943_RS18185 (3736558) 3736558..3737406 - 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
NP943_RS18190 (3737413) 3737413..3737790 - 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
NP943_RS18195 (3737793) 3737793..3738614 - 822 WP_001065365.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
NP943_RS18200 (3738611) 3738611..3739600 - 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
NP943_RS18205 (3739600) 3739600..3740886 - 1287 WP_000800457.1 peptidylprolyl isomerase SurA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-93)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10692.54 Da        Isoelectric Point: 10.3030

>T253091 WP_001160964.1 NZ_CP102061:3736247-3736531 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLIDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIK

Download         Length: 285 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT253091 WP_000125566.1 NZ_CP102061:3736011-3736244 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A061KX66

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References