Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3544904..3545739 | Replicon | chromosome |
| Accession | NZ_CP102061 | ||
| Organism | Escherichia coli strain C31 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | NP943_RS17255 | Protein ID | WP_000854759.1 |
| Coordinates | 3545362..3545739 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | NP943_RS17250 | Protein ID | WP_001295723.1 |
| Coordinates | 3544904..3545272 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP943_RS17220 (3540500) | 3540500..3541948 | + | 1449 | Protein_3359 | autotransporter adhesin family protein | - |
| NP943_RS17225 (3542019) | 3542019..3542214 | + | 196 | Protein_3360 | DUF905 family protein | - |
| NP943_RS17230 (3542332) | 3542332..3543150 | + | 819 | WP_001234738.1 | DUF932 domain-containing protein | - |
| NP943_RS17235 (3543492) | 3543492..3543965 | + | 474 | WP_001350782.1 | antirestriction protein | - |
| NP943_RS17240 (3543981) | 3543981..3544457 | + | 477 | WP_001186775.1 | RadC family protein | - |
| NP943_RS17245 (3544520) | 3544520..3544741 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| NP943_RS17250 (3544904) | 3544904..3545272 | + | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NP943_RS17255 (3545362) | 3545362..3545739 | + | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| NP943_RS17260 (3545736) | 3545736..3546224 | + | 489 | WP_000761690.1 | DUF5983 family protein | - |
| NP943_RS17265 (3546241) | 3546241..3546417 | + | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| NP943_RS17270 (3546523) | 3546523..3546672 | + | 150 | Protein_3369 | hypothetical protein | - |
| NP943_RS17275 (3547039) | 3547039..3547215 | + | 177 | Protein_3370 | helix-turn-helix domain-containing protein | - |
| NP943_RS17280 (3548006) | 3548006..3549628 | + | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T253089 WP_000854759.1 NZ_CP102061:3545362-3545739 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT253089 WP_001295723.1 NZ_CP102061:3544904-3545272 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |