Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1934139..1934973 | Replicon | chromosome |
| Accession | NZ_CP102061 | ||
| Organism | Escherichia coli strain C31 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PLF5 |
| Locus tag | NP943_RS09455 | Protein ID | WP_000854690.1 |
| Coordinates | 1934596..1934973 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1P7N8 |
| Locus tag | NP943_RS09450 | Protein ID | WP_001305076.1 |
| Coordinates | 1934139..1934507 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP943_RS09410 (1929221) | 1929221..1930348 | + | 1128 | Protein_1842 | hypothetical protein | - |
| NP943_RS09415 (1930424) | 1930424..1930879 | + | 456 | WP_000581502.1 | IrmA family protein | - |
| NP943_RS09420 (1930958) | 1930958..1931191 | + | 234 | WP_000902034.1 | DUF905 family protein | - |
| NP943_RS09425 (1931292) | 1931292..1932110 | + | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| NP943_RS09430 (1932165) | 1932165..1932650 | + | 486 | WP_000849565.1 | antirestriction protein | - |
| NP943_RS09435 (1932666) | 1932666..1933142 | + | 477 | WP_001186726.1 | RadC family protein | - |
| NP943_RS09440 (1933205) | 1933205..1933426 | + | 222 | WP_000692329.1 | DUF987 domain-containing protein | - |
| NP943_RS09445 (1933445) | 1933445..1934089 | + | 645 | WP_000094916.1 | hypothetical protein | - |
| NP943_RS09450 (1934139) | 1934139..1934507 | + | 369 | WP_001305076.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NP943_RS09455 (1934596) | 1934596..1934973 | + | 378 | WP_000854690.1 | TA system toxin CbtA family protein | Toxin |
| NP943_RS09460 (1934970) | 1934970..1935458 | + | 489 | WP_000761699.1 | DUF5983 family protein | - |
| NP943_RS09465 (1935475) | 1935475..1935672 | + | 198 | WP_000839293.1 | DUF957 domain-containing protein | - |
| NP943_RS09470 (1935757) | 1935757..1936602 | + | 846 | WP_001529401.1 | DUF4942 domain-containing protein | - |
| NP943_RS09475 (1936671) | 1936671..1937066 | + | 396 | WP_000208384.1 | DUF6088 family protein | - |
| NP943_RS09480 (1937059) | 1937059..1937992 | + | 934 | Protein_1856 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| NP943_RS09485 (1938409) | 1938409..1938579 | + | 171 | Protein_1857 | IS110 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 1938424..1938579 | 155 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14057.04 Da Isoelectric Point: 9.1510
>T253082 WP_000854690.1 NZ_CP102061:1934596-1934973 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13560.39 Da Isoelectric Point: 4.7830
>AT253082 WP_001305076.1 NZ_CP102061:1934139-1934507 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|