Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 813725..814556 Replicon chromosome
Accession NZ_CP102061
Organism Escherichia coli strain C31

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag NP943_RS04205 Protein ID WP_000854815.1
Coordinates 814182..814556 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag NP943_RS04200 Protein ID WP_001280918.1
Coordinates 813725..814093 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NP943_RS04155 (808814) 808814..809560 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
NP943_RS04160 (809643) 809643..809993 + 351 Protein_816 hypothetical protein -
NP943_RS04165 (810009) 810009..810419 + 411 WP_000846703.1 hypothetical protein -
NP943_RS04170 (810640) 810640..811458 + 819 WP_001542275.1 DUF932 domain-containing protein -
NP943_RS04175 (811458) 811458..811703 + 246 WP_001164966.1 hypothetical protein -
NP943_RS04180 (811797) 811797..812270 + 474 WP_001542276.1 antirestriction protein -
NP943_RS04185 (812286) 812286..812762 + 477 WP_001186200.1 RadC family protein -
NP943_RS04190 (812825) 812825..813046 + 222 WP_000692345.1 DUF987 domain-containing protein -
NP943_RS04195 (813065) 813065..813709 + 645 WP_000086752.1 hypothetical protein -
NP943_RS04200 (813725) 813725..814093 + 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NP943_RS04205 (814182) 814182..814556 + 375 WP_000854815.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
NP943_RS04210 (814553) 814553..814747 + 195 WP_000988600.1 DUF5983 family protein -
NP943_RS04215 (814793) 814793..814873 + 81 Protein_827 hypothetical protein -
NP943_RS04220 (815162) 815162..815242 - 81 WP_023441679.1 hypothetical protein -
NP943_RS04225 (815491) 815491..815916 + 426 WP_000422741.1 transposase -
NP943_RS04230 (815913) 815913..816263 + 351 WP_000624722.1 IS66 family insertion sequence element accessory protein TnpB -
NP943_RS04235 (816294) 816294..817907 + 1614 WP_000080195.1 IS66-like element ISEc23 family transposase -
NP943_RS04240 (817950) 817950..818084 + 135 WP_059338447.1 EutP/PduV family microcompartment system protein -
NP943_RS04245 (818185) 818185..818514 - 330 WP_000450409.1 DUF496 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T253079 WP_000854815.1 NZ_CP102061:814182-814556 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT253079 WP_001280918.1 NZ_CP102061:813725-814093 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References