Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 813725..814556 | Replicon | chromosome |
| Accession | NZ_CP102061 | ||
| Organism | Escherichia coli strain C31 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A066T988 |
| Locus tag | NP943_RS04205 | Protein ID | WP_000854815.1 |
| Coordinates | 814182..814556 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A061Y7A8 |
| Locus tag | NP943_RS04200 | Protein ID | WP_001280918.1 |
| Coordinates | 813725..814093 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP943_RS04155 (808814) | 808814..809560 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| NP943_RS04160 (809643) | 809643..809993 | + | 351 | Protein_816 | hypothetical protein | - |
| NP943_RS04165 (810009) | 810009..810419 | + | 411 | WP_000846703.1 | hypothetical protein | - |
| NP943_RS04170 (810640) | 810640..811458 | + | 819 | WP_001542275.1 | DUF932 domain-containing protein | - |
| NP943_RS04175 (811458) | 811458..811703 | + | 246 | WP_001164966.1 | hypothetical protein | - |
| NP943_RS04180 (811797) | 811797..812270 | + | 474 | WP_001542276.1 | antirestriction protein | - |
| NP943_RS04185 (812286) | 812286..812762 | + | 477 | WP_001186200.1 | RadC family protein | - |
| NP943_RS04190 (812825) | 812825..813046 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| NP943_RS04195 (813065) | 813065..813709 | + | 645 | WP_000086752.1 | hypothetical protein | - |
| NP943_RS04200 (813725) | 813725..814093 | + | 369 | WP_001280918.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NP943_RS04205 (814182) | 814182..814556 | + | 375 | WP_000854815.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| NP943_RS04210 (814553) | 814553..814747 | + | 195 | WP_000988600.1 | DUF5983 family protein | - |
| NP943_RS04215 (814793) | 814793..814873 | + | 81 | Protein_827 | hypothetical protein | - |
| NP943_RS04220 (815162) | 815162..815242 | - | 81 | WP_023441679.1 | hypothetical protein | - |
| NP943_RS04225 (815491) | 815491..815916 | + | 426 | WP_000422741.1 | transposase | - |
| NP943_RS04230 (815913) | 815913..816263 | + | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| NP943_RS04235 (816294) | 816294..817907 | + | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
| NP943_RS04240 (817950) | 817950..818084 | + | 135 | WP_059338447.1 | EutP/PduV family microcompartment system protein | - |
| NP943_RS04245 (818185) | 818185..818514 | - | 330 | WP_000450409.1 | DUF496 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13829.83 Da Isoelectric Point: 7.1326
>T253079 WP_000854815.1 NZ_CP102061:814182-814556 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A066T988 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A061Y7A8 |