Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 746762..747411 | Replicon | chromosome |
| Accession | NZ_CP101990 | ||
| Organism | Aeromicrobium sp. zg.Y50 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NP095_RS03760 | Protein ID | WP_232417304.1 |
| Coordinates | 746992..747411 (+) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | NP095_RS03755 | Protein ID | WP_232417305.1 |
| Coordinates | 746762..746995 (+) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP095_RS03740 (NP095_03740) | 743142..743360 | + | 219 | WP_232417308.1 | hypothetical protein | - |
| NP095_RS03745 (NP095_03745) | 743455..745455 | + | 2001 | WP_232417307.1 | AAA family ATPase | - |
| NP095_RS03750 (NP095_03750) | 745520..746404 | - | 885 | WP_232417306.1 | tyrosine-type recombinase/integrase | - |
| NP095_RS03755 (NP095_03755) | 746762..746995 | + | 234 | WP_232417305.1 | Arc family DNA-binding protein | Antitoxin |
| NP095_RS03760 (NP095_03760) | 746992..747411 | + | 420 | WP_232417304.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NP095_RS03765 (NP095_03765) | 747604..747960 | + | 357 | WP_232417303.1 | zinc ribbon domain-containing protein YjdM | - |
| NP095_RS03770 (NP095_03770) | 748049..749668 | + | 1620 | WP_187768899.1 | ATP-binding cassette domain-containing protein | - |
| NP095_RS03775 (NP095_03775) | 749796..749906 | + | 111 | Protein_730 | ATP-binding cassette domain-containing protein | - |
| NP095_RS03780 (NP095_03780) | 750258..750983 | + | 726 | WP_232417302.1 | DinB family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15267.41 Da Isoelectric Point: 4.5256
>T253073 WP_232417304.1 NZ_CP101990:746992-747411 [Aeromicrobium sp. zg.Y50]
MIVLDTNVISEIFRPQPEPRVLAWLESLTDDVAITSITLAELLAGVHRLPEGRRTTDLAAAIHAAIQPYRDTRSLLAFDE
DAAAEYAEVVVSRERAGLPISMVDAQIAAICRVNRAICATRNVKDFEATGVDVANPWRE
MIVLDTNVISEIFRPQPEPRVLAWLESLTDDVAITSITLAELLAGVHRLPEGRRTTDLAAAIHAAIQPYRDTRSLLAFDE
DAAAEYAEVVVSRERAGLPISMVDAQIAAICRVNRAICATRNVKDFEATGVDVANPWRE
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|