Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 3725762..3726410 | Replicon | chromosome |
Accession | NZ_CP101989 | ||
Organism | Cellulomonas wangsupingiae strain zg-Y908 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NP075_RS17135 | Protein ID | WP_227565908.1 |
Coordinates | 3725970..3726410 (+) | Length | 147 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NP075_RS17130 | Protein ID | WP_207339584.1 |
Coordinates | 3725762..3725980 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP075_RS17100 (NP075_17100) | 3720829..3721650 | - | 822 | WP_227565886.1 | alpha/beta hydrolase | - |
NP075_RS17105 (NP075_17105) | 3721787..3722098 | + | 312 | WP_227565901.1 | hypothetical protein | - |
NP075_RS17110 (NP075_17110) | 3722260..3723318 | + | 1059 | WP_227565903.1 | 5'-3' exonuclease H3TH domain-containing protein | - |
NP075_RS17115 (NP075_17115) | 3723331..3723705 | - | 375 | WP_227565904.1 | glyoxalase superfamily protein | - |
NP075_RS17120 (NP075_17120) | 3723898..3724665 | + | 768 | WP_227565905.1 | SDR family oxidoreductase | - |
NP075_RS17125 (NP075_17125) | 3724722..3725657 | + | 936 | WP_227565906.1 | aldo/keto reductase | - |
NP075_RS17130 (NP075_17130) | 3725762..3725980 | + | 219 | WP_207339584.1 | antitoxin | Antitoxin |
NP075_RS17135 (NP075_17135) | 3725970..3726410 | + | 441 | WP_227565908.1 | PIN domain-containing protein | Toxin |
NP075_RS17140 (NP075_17140) | 3726449..3727156 | - | 708 | WP_227565910.1 | TetR/AcrR family transcriptional regulator | - |
NP075_RS17145 (NP075_17145) | 3727235..3728716 | + | 1482 | WP_227565912.1 | MDR family MFS transporter | - |
NP075_RS17150 (NP075_17150) | 3728961..3729947 | + | 987 | WP_227565914.1 | polyphosphate polymerase domain-containing protein | - |
NP075_RS17155 (NP075_17155) | 3729944..3730615 | + | 672 | WP_227565916.1 | DUF4956 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 147 a.a. Molecular weight: 15785.21 Da Isoelectric Point: 8.1789
>T253071 WP_227565908.1 NZ_CP101989:3725970-3726410 [Cellulomonas wangsupingiae]
VTAEPCYLLDVNVLLALAADAHVHHRAAHRWFADVTAWATTPVTESAFVRLLSTPAVLGRTVLPIEAVAALRQMRTVPGH
RFLPDDASFADTTIDLTRMVGPRQVTDFHLVGLARRTGSTLATLDAKLRRSLHPADAHLVSVVPAA
VTAEPCYLLDVNVLLALAADAHVHHRAAHRWFADVTAWATTPVTESAFVRLLSTPAVLGRTVLPIEAVAALRQMRTVPGH
RFLPDDASFADTTIDLTRMVGPRQVTDFHLVGLARRTGSTLATLDAKLRRSLHPADAHLVSVVPAA
Download Length: 441 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|